LOADING...
   TM1718;TM1718
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1718    TM1718            JCSG 283574 Refining 11-JUN-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1718
DESCRIPTIOND-ribulose 5-phosphate 3-epimerase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X243_THEMA
DR SPTR; Q9X243 (flat text); Q9X243 (good view)
DR GenBank; AAD36784
DR Pfam; PF00834; Ribul_P_3_epim;
DR Interpro; IPR000056; Ribul_P_3_epim;
DR PDB; 1RPX; Highly similar; 07-APR-99; PROTEIN (RIBULOSE-PHOSPHATE 3-EPIMERASE);
DR PDB; 1TQJ; Highly similar; 31-AUG-04; RIBULOSE-PHOSPHATE 3-EPIMERASE;
DR PDB; 2FLI; Highly similar; 07-MAR-06; RIBULOSE-PHOSPHATE 3-EPIMERASE;
DR PDB; 3INP; Highly similar; 25-AUG-09; D-RIBULOSE-PHOSPHATE 3-EPIMERASE;
DR PDB; 1H1Y; Highly similar; 30-JAN-03; D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE;
DR PDB; 1H1Z; Highly similar; 30-JAN-03; D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE;
DR PDB; 4NU7; Highly similar; 18-DEC-13; RIBULOSE-PHOSPHATE 3-EPIMERASE;
DR PDB; 3CT7; Highly similar; 26-AUG-08; D-ALLULOSE-6-PHOSPHATE 3-EPIMERASE;
DR FFAS; 283574; Fold and function assignment.
DR TVPC; TM1718; Homologs in PDB, JCSG and SG center.
DR OVP; TM1718; Ortholog view popup.
DR TPM; TM1718; Target PDB monitor.
DR FSS; TM1718; Target function coverage.
PROPERTY Residues: 220 aa
Molecule Weight: 24803.48 Dalton
Isoelectric Point: 5.6
Extinction Coefficient: 5960
Gravy Index: .04
Number of Met residues: 9
Percentage of Met residues: 4.09 %
Number of Cys residues: 1
Percentage of Cys residues: 0.45 %
SEQUENCE  amino acids 220 aa
>TM1718  TM1718 ribulose-phosphate 3-epimerase
MVKIAASILACDLARLADEVKRVEEHVDMIHFDVMDGHFVPNISFGLPVLKALRKETKLP
ISVHLMITNPEDYIDRFIEEGADMVAIHYESTFHLHRLVHRVKDLGARAFVAINPHTPIN
LLSEIITDVDGVLVMSVNPGFSGQRFIARSLEKIRNLRKMVKELGLETEIMVDGGVNEEN
ASILVKNGATILVMGYGIFRNDNYVELIKSIKQEREEFAD

CDS  cDNA 660 bp
   1 atggtgaaaa tagcagcttc aattctcgcg tgtgaccttg caagactggc cgatgaagtg    60
  61 aaaagggtgg aagagcacgt ggatatgatc catttcgatg tcatggatgg tcattttgtt   120
 121 ccaaacattt cctttggact tcccgttctg aaagccctca ggaaagaaac aaaacttccc   180
 181 ataagtgtac acctgatgat caccaatccc gaagattaca tcgaccgctt catagaagaa   240
 241 ggagcagata tggtcgccat ccattacgaa tcgacctttc atctccacag actggtccat   300
 301 cgtgttaaag accttggagc acgggccttt gtggccataa acccgcatac ccccatcaat   360
 361 cttctttcag agatcataac cgacgtcgac ggtgtacttg tgatgagcgt caatcctggt   420
 421 ttctctggtc agaggttcat agcaaggagt cttgagaaaa taagaaatct gagaaagatg   480
 481 gtgaaggaac tgggattgga aacagaaatc atggtcgacg gcggtgtaaa cgaagagaac   540
 541 gcatcgatac tggttaaaaa cggtgcgacg atccttgtga tgggatacgg tatcttcaga   600
 601 aacgacaatt acgttgaact gataaagagc atcaaacagg aaagagagga atttgctgac   660
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1694735 1695397 2 Glimmer3 score 11.71 poor
Genemark probabilities .94   .91 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu