LOADING...
   TM1698;TM1698
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1698    TM1698            JCSG 283555 PDB Deposition 06-MAR-09              PDB id: 2gb3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1698
DESCRIPTIONAspartate aminotransferase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X224_THEMA
DR SPTR; Q9X224 (flat text); Q9X224 (good view)
DR GenBank; AAD36765
DR Pfam; PF00155; Aminotran_1_2;
DR Interpro; IPR001176; ACC_synthase;
DR Interpro; IPR004839; Aminotrans_I/II;
DR Interpro; IPR004838; NHtransf_1_BS;
DR PDB; 2GB3; Identical; 21-MAR-06; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1B5O; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR PDB; 1GC3; Highly similar; 05-SEP-01; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1GC4; Highly similar; 05-SEP-01; ASPARTATE AMINOTRANSFERASE;
DR PDB; 5BJ4; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR PDB; 1GCK; Highly similar; 14-NOV-01; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1B5P; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR PDB; 5BJ3; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR FFAS; 283555; Fold and function assignment.
DR TVPC; TM1698; Homologs in PDB, JCSG and SG center.
DR OVP; TM1698; Ortholog view popup.
DR TPM; TM1698; Target PDB monitor.
DR FSS; TM1698; Target function coverage.
PROPERTY Residues: 397 aa
Molecule Weight: 44915.5 Dalton
Isoelectric Point: 5.63
Extinction Coefficient: 30370
Gravy Index: -.05
Number of Met residues: 10
Percentage of Met residues: 2.52 %
Number of Cys residues: 6
Percentage of Cys residues: 1.51 %
SEQUENCE  amino acids 397 aa
>TM1698  TM1698 aspartate aminotransferase (aspC-2)
MDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEV
VYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVL
EPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYG
KDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGAR
VGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLK
KLEEHGLKRFTKPSGAFYITAELPVEDAEEFARWMLTDFNMDGETTMVAPLRGFYLTPGL
GKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSSRISC

CDS  cDNA 1191 bp
   1 atggatgtgt tctccgatcg tgtcctgctg accgaggaaa gcccaatcag aaaactggtt    60
  61 cccttcgctg aaatggcaaa gaagcgagga gtaaggatac accacctgaa cataggacag   120
 121 cccgatctga aaactcccga ggtgtttttt gagcgcatct acgaaaacaa gccggaagtg   180
 181 gtgtactact ctcactctgc gggtatctgg gaattgagag aggctttcgc atcttactac   240
 241 aaaagaagac agagggtaga tgtgaaaccg gaaaacgttc tggtgacgaa cggtggaagc   300
 301 gaagccattc ttttttcatt cgctgtgata gcaaatcctg gtgacgagat cctcgttctg   360
 361 gaaccgttct acgcgaatta caacgctttc gcgaagatcg ccggtgtgaa attgattccc   420
 421 gtaacgagga gaatggaaga aggattcgcc atccctcaga acctcgaaag tttcataaac   480
 481 gaaagaacga agggaatagt actctcaaat ccctgcaatc cgaccggggt ggtttatgga   540
 541 aaagacgaga tgagatatct cgtggaaata gcggaaagac acggactctt tctgatcgtc   600
 601 gacgaggtgt acagcgaaat cgtgtttcgg ggagaattcg caagtgccct cagcattgaa   660
 661 agtgacaaag tcgtagtgat agacagtgta tcgaagaagt tcagcgcctg tggggcgagg   720
 721 gtaggatgtc tgatcacgag aaacgaagaa ttgatatcac acgccatgaa actggctcag   780
 781 gggaggctcg ctccacctct gttagaacaa atcggatccg ttggtttgct gaatctcgac   840
 841 gattcctttt ttgatttcgt gagggaaacg tacagagaga gagtcgaaac agtattgaag   900
 901 aaactcgaag aacacggttt gaaacgtttc acaaaaccct caggtgcctt ctacataacc   960
 961 gcggaactcc ccgtggagga cgcggaagaa ttcgcaaggt ggatgctgac agatttcaac  1020
1021 atggatggtg aaacaaccat ggtcgctccc ctgaggggat tctatttgac tccagggctt  1080
1081 ggaaaaaaag agataagaat cgcgtgcgtg cttgagaagg atctcctttc cagggccatt  1140
1141 gacgtgttga tggaaggttt gaagatgttt tgctcgagcc gcatctcctg t  1191
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1676234 1677427 2 Glimmer3 score - -
Genemark probabilities .9   .07 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu