LOADING...
   TM1666;TM1666
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1666    TM1666            JCSG 283523 Tracing 05-JUL-15

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1666
DESCRIPTIONN-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1Z4_THEMA
DR SPTR; Q9X1Z4 (flat text); Q9X1Z4 (good view)
DR GenBank; AAD36733
DR Pfam; PF01546; Peptidase_M20;
DR Pfam; PF07687; M20_dimer;
DR Interpro; IPR001395; Aldo/ket_red;
DR Interpro; IPR002202; HMG-CoA_red;
DR Interpro; IPR002933; Peptidase_M20;
DR KEGG; 3.5.1.18; Enzyme page
DR FFAS; 283523; Fold and function assignment.
DR TVPC; TM1666; Homologs in PDB, JCSG and SG center.
DR OVP; TM1666; Ortholog view popup.
DR TPM; TM1666; Target PDB monitor.
DR FSS; TM1666; Target function coverage.
PROPERTY Residues: 396 aa
Molecule Weight: 44195.87 Dalton
Isoelectric Point: 5.03
Extinction Coefficient: 51910
Gravy Index: -.33
Number of Met residues: 6
Percentage of Met residues: 1.52 %
Number of Cys residues: 3
Percentage of Cys residues: 0.76 %
SEQUENCE  amino acids 396 aa
>TM1666  TM1666 succinyl-diaminopimelate desuccinylase, putative
MEITKRIEELREEMVESLKKFISINSVNPAFGGPGEKEKADWLEGLLRDFGFEVDRCDVR
DDRGIWRSNIVAKIPGKNREKTLWIVTHIDTVPPGDLSLWETDPFVPVVKDGKVYGRGAE
DNGGSMIASIYAGKALIDLGITPEYNFGLALVADEEAGSEYGIQYLIEKGLFSPEDMFLV
PDAGNEKGDFIEIAEKSILWFKVMVNGKQGHASRPQTTENALRKGAHLITEIDEALHRKY
SDRDELFDEPLSTFEPTRAEKTVDNVNTVPGRFVFYFDCRVLPRYNLDEVLSIVKSILDG
RGAELEVVVKQPAPEPTPPDSELVVKLSNVLRSLRGLEAKVGGIGGGTCAAFFRKKGWPA
VVWSTIDETAHQPNEYRRISHMVEDAKVFALLGTER

CDS  cDNA 1188 bp
   1 atggagatca caaaaagaat agaagagctc agagaggaaa tggtggaatc cttgaagaaa    60
  61 ttcatctcca tcaactcggt gaatcctgct tttggaggcc cgggagagaa agaaaaggcc   120
 121 gactggcttg aaggcctcct cagggatttc ggtttcgagg tcgaccgctg cgatgtgaga   180
 181 gacgataggg gtatatggcg atcgaacatt gtggcaaaga ttccgggaaa aaatagagaa   240
 241 aaaacgctct ggatcgtgac tcacatcgac acggtaccac cgggagatct ctctttgtgg   300
 301 gagacggatc ctttcgtgcc cgttgtgaag gacgggaaag tttacggtag gggagccgaa   360
 361 gacaacggag gttccatgat agcctccata tacgctggga aggcccttat cgaccttggt   420
 421 atcactcccg agtacaactt cggtcttgca ctcgttgccg atgaggaggc gggaagtgag   480
 481 tatggaatcc aatatctgat agaaaaaggg ttgttcagcc cagaagacat gttcctggtc   540
 541 ccggatgctg gaaacgaaaa gggagacttc atcgagatcg cagagaagag catcctgtgg   600
 601 ttcaaagtga tggtgaacgg aaaacaggga cacgcttcaa gaccgcaaac aacagagaac   660
 661 gctctcagaa agggtgcaca tctcataaca gagatagatg aagcactcca caggaaatac   720
 721 tccgatagag atgaactctt cgatgaaccg ctcagcacgt tcgagcccac tcgcgctgaa   780
 781 aaaactgtgg acaacgtgaa caccgttccc ggcagattcg tcttttactt cgactgcagg   840
 841 gtcctgcctc gctacaatct cgacgaggtg ctgtccatcg tcaagtcgat tctcgatgga   900
 901 agaggtgcag agctggaggt cgtcgtgaaa cagcccgcgc ccgagccaac tccacccgat   960
 961 tcggaactcg tggtgaaact ttccaatgtt ttgagaagtc taagagggct ggaagcgaaa  1020
1021 gtgggaggta taggtggagg cacctgcgct gcgttcttca gaaagaaagg ctggcccgcg  1080
1081 gtcgtctgga gcacaataga cgagactgct catcagccca acgagtaccg aaggatatcg  1140
1141 cacatggtgg aagatgcgaa ggtgttcgca cttctcggaa ccgagagg  1188
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1652165 1653355 -2 Glimmer3 score 13.16 good
Genemark probabilities .94   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu