LOADING...
   TM1661;TM1661
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1661    TM1661            JCSG 283518 PDB Deposition 02-MAY-01              PDB id: 1lme

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1661
DESCRIPTIONPeptide deformylase (EC 3.5.1.88) (PDF) (Polypeptide deformylase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: REMOVES THE FORMYL GROUP FROM THE N-TERMINAL MET OF
NEWLY SYNTHESIZED PROTEINS. REQUIRES AT LEAST A DIPEPTIDE FOR AN
EFFICIENT RATE OF REACTION. N-TERMINAL L-METHIONINE IS A
PREREQUISITE FOR ACTIVITY BUT THE ENZYME HAS BROAD SPECIFICITY AT
OTHER POSITIONS (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: FORMYL-L-METHIONYL PEPTIDE + H(2)O = FORMATE +
METHIONYL PEPTIDE.
-!- COFACTOR: BINDS 1 IRON(II) ION (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE POLYPEPTIDE DEFORMYLASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; DEF_THEMA
DR SPTR; P96113 (flat text); P96113 (good view)
DR GenBank; CAA71356
DR Pfam; PF01327; Pep_deformylase;
DR Interpro; IPR000181; Fmet_deformylase;
DR PDB; 1LME; Identical; 24-JUN-03; PEPTIDE DEFORMYLASE;
DR PDB; 4DR9; Highly similar; 16-JAN-13; PEPTIDE DEFORMYLASE;
DR PDB; 4DR8; Highly similar; 06-MAR-13; PEPTIDE DEFORMYLASE;
DR PDB; 1V3Y; Highly similar; 28-DEC-04; PEPTIDE DEFORMYLASE;
DR PDB; 1RL4; Highly similar; 09-DEC-03; FORMYLMETHIONINE DEFORMYLASE;
DR PDB; 1RQC; Highly similar; 20-JAN-04; FORMYLMETHIONINE DEFORMYLASE;
DR PDB; 3CPM; Highly similar; 22-JUL-08; PEPTIDE DEFORMYLASE, CHLOROPLAST;
DR PDB; 1N5N; Highly similar; 24-JUN-03; PEPTIDE DEFORMYLASE;
DR KEGG; 3.5.1.88; Enzyme page
DR FFAS; 283518; Fold and function assignment.
DR TVPC; TM1661; Homologs in PDB, JCSG and SG center.
DR OVP; TM1661; Ortholog view popup.
DR TPM; TM1661; Target PDB monitor.
DR FSS; TM1661; Target function coverage.
PROPERTY Residues: 164 aa
Molecule Weight: 19023.15 Dalton
Isoelectric Point: 7.82
Extinction Coefficient: 8940
Gravy Index: -.33
Number of Met residues: 5
Percentage of Met residues: 3.05 %
Number of Cys residues: 1
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 164 aa
>TM1661  TM1661 polypeptide deformylase (def)
MYRIRVFGDPVLRKRAKPVTKFDENLKKTIERMIETMYHYDGVGLAAPQVGISQRFFVMD
VGNGPVAVINPEILEIDPETEVAEEGCLSFPEIFVEIERSKRIKVKYQNTRGEYVEEELE
GYAARVFQHEFDHLNGVLIIDRISPAKRLLLRKKLMDIARTVKR

CDS  cDNA 492 bp
   1 atgtacagaa taagagtctt tggagatccc gtcttgagaa agagggcaaa acccgttaca    60
  61 aagttcgacg agaacctgaa aaagaccata gaaagaatga tagagacgat gtatcactac   120
 121 gacggtgtgg gactcgcggc accgcaggtt ggaatatctc agaggttctt cgtcatggac   180
 181 gttggaaatg gtccggttgc cgtgataaat ccggagattc ttgaaatcga tccagaaact   240
 241 gaagtagcag aagaggggtg cctcagcttt cccgagatct tcgtcgagat agaaaggagc   300
 301 aaaagaataa aggtcaaata ccagaacaca aggggagaat acgtggaaga agaactggaa   360
 361 ggttacgctg caagggtttt tcagcacgag ttcgatcatc tgaacggagt tttgatcatc   420
 421 gatcgaatca gtccagcaaa gcgccttttg ctcagaaaga aactcatgga catagcaaga   480
 481 accgttaaga ga   492
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1649026 1649520 -1 Glimmer3 score 14.63 good
Genemark probabilities .91   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu