LOADING...
   TM1645;TM1645
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1645    TM1645            JCSG 283502 PDB Deposition 03-JUL-09              PDB id: 1o4u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1645
DESCRIPTIONtype II quinolic acid phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1X8_THEMA
DR SPTR; Q9X1X8 (flat text); Q9X1X8 (good view)
DR GenBank; AAD36712
DR Pfam; PF01729; QRPTase_C;
DR Pfam; PF02749; QRPTase_N;
DR Interpro; IPR004393; NadC;
DR Interpro; IPR002638; Q_phspho_trans;
DR PDB; 1O4U; Identical; 22-JUL-03; TYPE II QUINOLIC ACID PHOSPHORIBOSYLTRANSFERASE;
DR PDB; 2B7N; Highly similar; 14-FEB-06; PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE;
DR PDB; 2B7P; Highly similar; 14-FEB-06; PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE;
DR PDB; 2B7Q; Highly similar; 21-FEB-06; PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE;
DR PDB; 4KWV; Highly similar; 02-OCT-13; NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE [CARBOXYL CHAIN: A,;
DR PDB; 4KWW; Highly similar; 02-OCT-13; NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE [CARBOXYL CHAIN: A,;
DR PDB; 2JBM; Highly similar; 13-NOV-07; NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE;
DR PDB; 5AYY; Highly similar; 03-FEB-16; NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE [CARBOXYL CHAIN: A,;
DR KEGG; 2.4.2.19; Enzyme page
DR FFAS; 283502; Fold and function assignment.
DR TVPC; TM1645; Homologs in PDB, JCSG and SG center.
DR OVP; TM1645; Ortholog view popup.
DR TPM; TM1645; Target PDB monitor.
DR FSS; TM1645; Target function coverage.
PROPERTY Residues: 273 aa
Molecule Weight: 30179.27 Dalton
Isoelectric Point: 5.08
Extinction Coefficient: 5960
Gravy Index: .03
Number of Met residues: 8
Percentage of Met residues: 2.93 %
Number of Cys residues: 1
Percentage of Cys residues: 0.37 %
SEQUENCE  amino acids 273 aa
>TM1645  TM1645 nicotinate-nucleotide pyrophosphorylase (nadC)
MEKILDLLMSFVKEDEGKLDLASFPLRNTTAGAHLLLKTENVVASGIEVSRMFLEKMGLL
SKFNVEDGEYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFSVATTTRRFAEKLKHAKI
AATRKILPGLGVLQKIAVVHGGGDPHRLDLSGCVMIKDNHLKMYGSAERAVQEVRKIIPF
TTKIEVEVENLEDALRAVEAGADIVMLDNLSPEEVKDISRRIKDINPNVIVEVSGGITEE
NVSLYDFETVDVISSSRLTLQEVFVDLSLEIQR

CDS  cDNA 819 bp
   1 atggagaaaa tcctcgacct tttgatgagt tttgtcaaag aagatgaggg aaaactcgat    60
  61 ctcgcctctt tcccgcttcg aaacacaact gccggcgctc atcttctttt gaaaacggaa   120
 121 aacgtggttg cctctggtat agaggtttct cgaatgttcc tggaaaaaat gggattgctt   180
 181 tctaaattta acgtggaaga cggagagtac ttggaaggaa ccggggtgat aggagagata   240
 241 gaaggcaaca cctacaagct tttggtcgcg gagagaactc tcctcaacgt tctctctgtt   300
 301 atgttttctg tggctacaac aacaagaagg ttcgccgaaa aacttaaaca cgcaaagata   360
 361 gcagcgacga ggaagatcct gcccggtctg ggagttcttc aaaagatcgc tgtggtgcac   420
 421 ggaggaggag atccccacag gctcgatctg agcggatgtg tgatgataaa agacaaccat   480
 481 ctgaagatgt acggcagtgc cgaacgggct gttcaggagg tcagaaagat aatacccttc   540
 541 accacaaaaa tagaagtcga agtggaaaat ctggaggatg cactgagagc ggttgaagct   600
 601 ggagcggata ttgtcatgct ggacaatctc tctcccgaag aagtgaagga catatccagg   660
 661 agaataaaag atatcaatcc taacgtgatc gtggaagtgt ccggtgggat cacggaagag   720
 721 aacgtttctc tctacgactt tgaaacagtc gatgtgatct cctcgagcag actgacactc   780
 781 caggaagtgt ttgtggatct ctcactcgag attcagcgg   819
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1634301 1635122 3 Glimmer3 score 13.86 good
Genemark probabilities .94   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu