LOADING...
   TM1643;TM1643
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1643    TM1643            JCSG 283500 PDB Deposition 02-JUN-27              PDB id: 1j5p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1643
DESCRIPTIONAspartate dehydrogenase [same functional role as] (EC 1.4.3.16)
ORGANISMThermotoga maritima
COMMENT The first step of the de novo NAD biosynthesis in T.maritima and several archaea.
Nonorthologous replacement of Aspartate oxidase (nadB gene in E.coli and most prokaryotes).
Genome and Functional context: a conserved chromosomal cluster (TM1643-TM1644-TM1645) with genes encoding the enzymes of the next two steps: quinolinate synthase and quinolinate phosphoribosyl transferase.
Function experimentally verified: Yang Z et al., J Biol Chem. 2003 278(10):8804-8.( see Reference )
DR UNIPROT; ASPD_THEMA
DR SPTR; Q9X1X6 (flat text); Q9X1X6 (good view)
DR GenBank; AAD36710
DR Pfam; PF01958; DUF108;
DR Pfam; PF03447; NAD_binding_3;
DR Interpro; IPR002811; Asp_dh;
DR PDB; 1H2H; Identical; 15-AUG-02; HYPOTHETICAL PROTEIN TM1643;
DR PDB; 1J5P; Identical; 10-JUL-02; ASPARTATE DEHYDROGENASE;
DR PDB; 2DC1; Highly similar; 26-DEC-06; L-ASPARTATE DEHYDROGENASE;
DR FFAS; 283500; Fold and function assignment.
DR TVPC; TM1643; Homologs in PDB, JCSG and SG center.
DR OVP; TM1643; Ortholog view popup.
DR TPM; TM1643; Target PDB monitor.
DR FSS; TM1643; Target function coverage.
PROPERTY Residues: 241 aa
Molecule Weight: 26638.52 Dalton
Isoelectric Point: 7.75
Extinction Coefficient: 8940
Gravy Index: .12
Number of Met residues: 4
Percentage of Met residues: 1.66 %
Number of Cys residues: 1
Percentage of Cys residues: 0.41 %
SEQUENCE  amino acids 241 aa
>TM1643  TM1643 conserved hypothetical protein
MTVLIIGMGNIGKKLVELGNFEKIYAYDRISKDIPGVVRLDEFQVPSDVSTVVECASPEA
VKEYSLQILKNPVNYIIISTSAFADEVFRERFFSELKNSPARVFFPSGAIGGLDVLSSIK
DFVKNVRIETIKPPKSLGLDLKGKTVVFEGSVEEASKLFPRNINVASTIGLIVGFEKVKV
TIVADPAMDHNIHIVRISSAIGNYEFKIENIPSPENPKTSMLTVYSILRTLRNLESKIIF
G

CDS  cDNA 723 bp
   1 atgactgttc tgatcatcgg aatgggaaat attgggaaaa aactcgtaga actgggaaat    60
  61 ttcgagaaaa tctacgctta cgacaggatt tcaaaagaca ttccgggagt cgttcgcctc   120
 121 gatgaattcc aggttccttc agacgtcagc acggttgtcg aatgcgcttc tccagaagcc   180
 181 gttaaagaat actcacttca gatcctgaaa aaccctgtga actacatcat aatcagcacc   240
 241 agcgctttcg cggacgaagt tttcagggaa aggttcttca gcgaattgaa aaattcacca   300
 301 gccagggtct ttttcccatc cggtgccatc ggcggtctcg atgttctctc ttccatcaaa   360
 361 gatttcgtca aaaacgtccg catagaaaca ataaaacctc caaagagtct cggcctggat   420
 421 ttgaaaggta aaacagtcgt gttcgaagga agtgttgagg aagcgtcaaa actatttcca   480
 481 agaaacatca acgtagcgtc gaccatcggc cttatagtgg gctttgaaaa ggtaaaggta   540
 541 acaatagtgg cagatcccgc catggatcac aacatccaca ttgtaagaat ctcctccgct   600
 601 atcggaaact acgaattcaa aatagagaat attccatcac cagaaaaccc aaaaacaagt   660
 661 atgctaacag tctattcgat tctcagaacc ttgagaaatc tcgaatcaaa aatcatattc   720
 721 gga   723
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1632662 1633387 2 Glimmer3 score 12 good
Genemark probabilities .84   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu