LOADING...
   TM1635;TM1635
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1635    TM1635            JCSG 372975 PDB Deposition 07-JUN-11              PDB id: 2q8u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1635
DESCRIPTIONthe first eubacterial Mre11 nuclease
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1X0_THEMA
DR SPTR; Q9X1X0 (flat text); Q9X1X0 (good view)
DR GenBank; AAD36702
DR Pfam; PF00149; Metallophos;
DR Interpro; IPR004843; M-pesterase;
DR Interpro; IPR004593; SbcD;
DR PDB; 2Q8U; Identical; 26-JUN-07; EXONUCLEASE, PUTATIVE;
DR PDB; 4NZV; Identical; 08-JAN-14; EXONUCLEASE, PUTATIVE;
DR PDB; 4O43; Identical; 08-JAN-14; EXONUCLEASE, PUTATIVE;
DR PDB; 4O4K; Identical; 08-JAN-14; EXONUCLEASE, PUTATIVE;
DR PDB; 4O5G; Identical; 08-JAN-14; EXONUCLEASE, PUTATIVE;
DR PDB; 4O24; Identical; 15-JAN-14; EXONUCLEASE, PUTATIVE;
DR PDB; 3THN; Identical; 12-OCT-11; EXONUCLEASE, PUTATIVE;
DR PDB; 3QG5; Identical; 20-APR-11; RAD50;
DR KEGG; 3.-.-.-; Enzyme page
DR FFAS; 283492; Fold and function assignment.
DR TVPC; TM1635; Homologs in PDB, JCSG and SG center.
DR OVP; TM1635; Ortholog view popup.
DR TPM; TM1635; Target PDB monitor.
DR FSS; TM1635; Target function coverage.
PROPERTY Residues: 385 aa
Molecule Weight: 44683.91 Dalton
Isoelectric Point: 5.46
Extinction Coefficient: 35870
Gravy Index: -.44
Number of Met residues: 6
Percentage of Met residues: 1.56 %
Number of Cys residues: 1
Percentage of Cys residues: 0.26 %
SEQUENCE  amino acids 385 aa
>TM1635  TM1635 exonuclease, putative
MINLKELKILHTSDWHLGVTSWTSSRPVDRREELKKALDKVVEEAEKREVDLILLTGDLL
HSRNNPSVVALHDLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSDITFVMSFE
PVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALKKEDFAIFMGH
FTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQKQPLTIYPGSLIRIDF
GEEADEKGAVFVELKRGEPPRYERIDASPLPLKTLYYKKIDTSALKSIRDFCRNFPGYVR
VVYEEDSGILPDLMGEIDNLVKIERKSRREIEEVLRESPEEFKEELDKLDYFELFKEYLK
KREENHEKLLKILDELLDEVKKSEA

CDS  cDNA 1155 bp
   1 gtgattaatt tgaaggagct caaaatactc cacacatccg actggcacct cggtgtcacc    60
  61 tcgtggacca gttcgcgtcc agtagataga cgtgaagaac tgaagaaagc gctcgataaa   120
 121 gtagtcgaag aagccgaaaa gagagaggtc gatctgattc ttttaacggg tgatcttctt   180
 181 cactcgagga acaatccctc agtcgtcgct ctgcacgatc ttctggatta tctgaagagg   240
 241 atgatgagaa cagctcctgt ggttgtactt ccaggaaacc acgattggaa ggggttgaaa   300
 301 ctcttcggaa acttcgtaac atcgatctca agcgacataa cctttgtcat gtctttcgaa   360
 361 cctgtggatg tagaagccaa acggggccag aaggtgagaa ttcttccctt tccatatcct   420
 421 gacgagtcgg aagctttgag aaaaaacgag ggagacttcc ggttcttcct cgaatccaga   480
 481 ctcaataaac tttacgaaga agcgctgaag aaggaagatt tcgctatctt catgggtcac   540
 541 ttcactgttg aagggctcgc gggttacgct ggaatcgagc aaggaagaga gatcatcata   600
 601 aacagagcgt tgattccgtc ggtggttgat tacgctgcgc tcgggcacat tcatagtttt   660
 661 cgagagattc agaagcaacc tctcaccata taccctggct ctctcataag gatagatttc   720
 721 ggagaagaag cggacgaaaa gggagcggtc tttgttgagc tgaaaagagg agaaccgccc   780
 781 aggtatgaaa gaatagacgc ctcccctctt ccgttgaaaa ctctctacta caaaaagata   840
 841 gacacctctg ccttgaaaag cataagggat ttctgcagga attttcctgg ttacgtgagg   900
 901 gtggtttatg aagaagactc cggtattctt cccgacctga tgggagagat agataatctg   960
 961 gtgaagatag agagaaagtc aagaagagag atagaggagg tgcttcgaga aagcccggaa  1020
1021 gagttcaaag aagaactgga caagcttgat tatttcgaac tcttcaagga gtatttgaag  1080
1081 aagagagaag aaaaccacga aaagctgttg aaaatcctgg atgagcttct cgatgaggtg  1140
1141 aaaaagagtg aggcc  1155
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1622414 1623571 2 Glimmer3 score - -
Genemark probabilities .9   .59 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu