LOADING...
   TM1631;TM1631
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1631    TM1631            JCSG 283488 PDB Deposition 04-NOV-16              PDB id: 1vpq

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1631
DESCRIPTIONPutative DNA-acting enzyme (DUF72 family)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1W6_THEMA
DR SPTR; Q9X1W6 (flat text); Q9X1W6 (good view)
DR GenBank; AAD36698
DR Pfam; PF01904; DUF72;
DR Interpro; IPR002763; DUF72;
DR PDB; 1VPQ; Identical; 23-NOV-04; HYPOTHETICAL PROTEIN TM1631;
DR PDB; 1VPY; Highly similar; 07-DEC-04; PROTEIN (HYPOTHETICAL PROTEIN EF0366);
DR PDB; 1ZTV; Highly similar; 14-JUN-05; HYPOTHETICAL PROTEIN;
DR FFAS; 283488; Fold and function assignment.
DR TVPC; TM1631; Homologs in PDB, JCSG and SG center.
DR OVP; TM1631; Ortholog view popup.
DR TPM; TM1631; Target PDB monitor.
DR FSS; TM1631; Target function coverage.
PROPERTY Residues: 261 aa
Molecule Weight: 31725.55 Dalton
Isoelectric Point: 5.87
Extinction Coefficient: 62800
Gravy Index: -.61
Number of Met residues: 5
Percentage of Met residues: 1.92 %
Number of Cys residues: 1
Percentage of Cys residues: 0.38 %
SEQUENCE  amino acids 261 aa
>TM1631  TM1631 conserved hypothetical protein
MVYVGTSGFSFEDWKGVVYPEHLKPSQFLKYYWAVLGFRIVELNFTYYTQPSWRSFVQML
RKTPPDFYFTVKTPGSVTHVLWKEGKDPKEDMENFTRQIEPLIEEQRLKMTLAQFPFSFK
FSRKNVEYLEKLRESYPYELAVEFRHYSWDREETYEFLRNHGITFVVVDEPKLPGLFPYR
PITTTDYAYFRFHGRNERWFEAEGEERYDYLYSEEELKTLFEDVVELSRRVKETYVFFNN
CYKGQAAINALQFKKMLEERV

CDS  cDNA 783 bp
   1 atggtttacg tgggaacgag cggtttttcc tttgaagatt ggaagggagt ggtgtacccc    60
  61 gaacatttga aaccttccca gtttctgaag tactactggg cggtgcttgg attcagaatc   120
 121 gtggaattga atttcactta ttacacacaa ccatcgtggc gctcctttgt tcagatgttg   180
 181 agaaagaccc ctcccgattt ctattttacc gtaaagaccc caggaagcgt cacacacgtt   240
 241 ctctggaaag agggaaaaga tccgaaagag gacatggaaa atttcacacg tcaaatagag   300
 301 cctctaatag aagaacaaag actaaagatg actttagcac agtttccatt ttctttcaaa   360
 361 ttctccagaa aaaacgtgga gtatcttgaa aaactgagag aaagctaccc gtacgaactc   420
 421 gctgtggagt tcagacacta ctcctgggac agagaagaaa catatgaatt cttgagaaat   480
 481 catggtataa cctttgtagt ggtggacgaa ccgaagcttc ccggattgtt cccttatcga   540
 541 cccataacaa caactgatta cgcctacttc agatttcatg gaaggaacga aagatggttc   600
 601 gaggccgaag gggaagaaag gtacgattac ctctacagcg aggaagaact gaaaactctt   660
 661 tttgaagatg ttgtagaact ttcacgaaga gtgaaggaaa cttatgtctt cttcaacaac   720
 721 tgttacaaag gtcaggcggc aataaacgcc ttgcagttca agaagatgct ggaggagaga   780
 781 gtg   783
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1618388 1619173 -2 Glimmer3 score 12.17 good
Genemark probabilities .8   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu