LOADING...
   TM1622;TM1622
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1622    TM1622            JCSG 358480 PDB Deposition 05-FEB-16              PDB id: 1vr8

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1622
DESCRIPTIONGTP binding regulator
ORGANISMThermotoga maritima
COMMENTMember of the structural family consisting of the TM1622, Mog1p, a
regulatory protein for the nuclear transport of Ran GTPase (1jhs, multiple
homologs in many organisms, including human) and two recent structures,
Hypothetical Protein Pa94 From Pseudomonas Aeruginosa (1tu1, solved by
Midwest, many homologs in various bacteria) and Psbp Protein, regulator of
photosystem II complex from higher plants (1v2b, multiple homologs in
bacteria and plants) and. The functions of the Mog1p and Psbp are known and
there is a connection, they both bind GTP and bind (and regulate) GTPases.
The connection between Mog1p, PA94 and Psbp (but not TM1622) can be made
(with some effort) on the sequence level, but structures, especially when
analyzed in a group, are really similar. The Pseudomonas protein is most
similar to TM1622, it even has the same additional domain (a small beta
sheet) as TM1622, but rotated away and swapped with a neighbor in a crystal
lattice (domain swapping). Interestingly, TM1623 has a domain
homologous to Ran GTPase.

see http://fatcat.burnham.org/POSA-cgi/cgi/POSAcheck.pl?id=result_110_noname for mutliple structural alignment
DR UNIPROT; Q9X1V7_THEMA
DR SPTR; Q9X1V7 (flat text); Q9X1V7 (good view)
DR GenBank; AAD36689
DR PDB; 1VR8; Identical; 15-MAR-05; GTP BINDING REGULATOR;
DR FFAS; 283479; Fold and function assignment.
DR TVPC; TM1622; Homologs in PDB, JCSG and SG center.
DR OVP; TM1622; Ortholog view popup.
DR TPM; TM1622; Target PDB monitor.
DR FSS; TM1622; Target function coverage.
PROPERTY Residues: 154 aa
Molecule Weight: 17842.09 Dalton
Isoelectric Point: 9.21
Extinction Coefficient: 33920
Gravy Index: -.03
Number of Met residues: 5
Percentage of Met residues: 3.25 %
Number of Cys residues: 1
Percentage of Cys residues: 0.65 %
SEQUENCE  amino acids 154 aa
>TM1622  TM1622 hypothetical protein
MRRSLFLVVVLLMLSSCTLIKIVVPPEAYSLDTAIFVLETRDYRLSDVKEIDSYGDVEMK
GKVAVFETEYGPVFLYVYKGEEAKKIWKKLNGRAGFVSIRSVLDLPNMGKFSTVSNGKKI
VAWWRKNWLFIVEGKNGVEEFVKHVYRVYEEMKQ

CDS  cDNA 462 bp
   1 gtgaggcgtt ctttgtttct cgttgttgta ctcctgatgc tttcttcatg cacgttgata    60
  61 aaaatagtgg taccaccgga ggcctattct ctggatacag ccatcttcgt tctggagacc   120
 121 agagattaca gattgtcgga tgtgaaggag atagacagtt atggagacgt ggaaatgaag   180
 181 ggcaaagttg cggtttttga aacggagtat ggccctgttt tcctctacgt ctacaaaggc   240
 241 gaagaagcga agaagatctg gaagaaattg aacggcagag ccgggtttgt gtccataaga   300
 301 agtgttctgg acctgcccaa catgggaaaa ttctccacag tatcgaacgg aaagaagatc   360
 361 gtcgcctggt ggagaaaaaa ctggcttttc atcgtcgaag ggaaaaacgg tgtagaagaa   420
 421 tttgtgaagc acgtttatag agtctatgag gagatgaaac ag   462
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1609394 1609858 -2 Glimmer3 score 12.95 good
Genemark probabilities .8   .29 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu