LOADING...
   TM1621;TM1621
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1621    TM1621            JCSG 283478 PDB Deposition 03-FEB-12              PDB id: 1o1z

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1621
DESCRIPTIONGlycerophosphodiester phosphodiesterase (GDPD) (TM1621).
ORGANISMThermotoga maritima
COMMENTTM1621 contains a new domain (residues 36-80) with a novel fold.
We named it GDPD-I domain. A conserved cluster of hydrophilic residues adjacent to and in this domain suggests a catalytic function.
DR UNIPROT; Q9X1V6_THEMA
DR SPTR; Q9X1V6 (flat text); Q9X1V6 (good view)
DR GenBank; AAD36688
DR Pfam; PF03009; GDPD;
DR Interpro; IPR004129; GDPD;
DR Interpro; IPR000909; PI_PLC_Xdom;
DR PDB; 1O1Z; Identical; 01-APR-03; GLYCEROPHOSPHODIESTER PHOSPHODIESTERASE;
DR PDB; 4OEC; Highly similar; 14-JAN-15; GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTERASE;
DR PDB; 2PZ0; Highly similar; 01-APR-08; GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTERASE;
DR PDB; 1V8E; Highly similar; 18-JAN-05; PUTATIVE GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTERASE;
DR PDB; 1VD6; Highly similar; 05-APR-05; GLYCEROPHOSPHORYL DIESTER PHOSPHODIESTERASE;
DR PDB; 3QVQ; Highly similar; 13-APR-11; PHOSPHODIESTERASE OLEI02445;
DR KEGG; 3.1.4.46; Enzyme page
DR FFAS; 283478; Fold and function assignment.
DR TVPC; TM1621; Homologs in PDB, JCSG and SG center.
DR OVP; TM1621; Ortholog view popup.
DR TPM; TM1621; Target PDB monitor.
DR FSS; TM1621; Target function coverage.
PROPERTY Residues: 222 aa
Molecule Weight: 25700.1 Dalton
Isoelectric Point: 5.18
Extinction Coefficient: 18910
Gravy Index: -.32
Number of Met residues: 2
Percentage of Met residues: 0.90 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 222 aa
>TM1621  TM1621 hypothetical protein
MIVLGHRGYSAKYLENTLEAFMKAIEAGANGVELDVRLSKDGKVVVSHDEDLKRLFGLDV
KIRDATVSELKELTDGKITTLKEVFENVSDDKIINIEIKEREAADAVLEISKKRKNLIFS
SFDLDLLDEKFKGTKYGYLIDEENYGSIENFVERVEKERPYSLHVPYQAFELEYAVEVLR
SFRKKGIVIFVWTLNDPEIYRKIRREIDGVITDEVELFVKLR

CDS  cDNA 666 bp
   1 gtgatcgttc tggggcacag ggggtactct gcgaaatacc ttgaaaacac cctcgaagcg    60
  61 tttatgaagg cgatagaagc gggggcaaac ggtgtggaac tggacgtgag actgtcgaag   120
 121 gacgggaaag ttgttgtctc acacgacgaa gatttgaaaa gactgtttgg actggacgtg   180
 181 aagataagag atgccactgt gtctgagctg aaagaattaa cagatggaaa gataaccact   240
 241 ttgaaagaag tgttcgaaaa cgtttctgat gataaaatca ttaacatcga gataaaagaa   300
 301 agagaagcgg cagatgctgt tctagaaatt tcgaaaaaaa gaaagaatct gatattctct   360
 361 tctttcgatc tggacctgct cgatgagaaa ttcaagggga caaaatacgg ctatctgata   420
 421 gatgaagaga actacggaag tatagaaaac tttgtcgaga gagtagaaaa agaacgtcct   480
 481 tattcgctcc acgtaccgta ccaggcgttc gaattagaat acgcagtaga ggttttgaga   540
 541 agtttcagaa aaaaaggaat cgtgatcttt gtctggacgc tgaacgatcc ggaaatttat   600
 601 agaaagatac gcagagaaat agacggggtt atcacggacg aagtggaact cttcgtgaag   660
 661 ttgagg   666
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1608729 1609397 -3 Glimmer3 score 13.95 good
Genemark probabilities .95   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu