LOADING...
   TM1620;TM1620
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1620    TM1620            JCSG 359877 PDB Deposition 04-MAY-13              PDB id: 1vke

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1620
DESCRIPTIONCarboxymuconolactone decarboxylase family protein possibly involved in antioxidative response
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1V5_THEMA
DR SPTR; Q9X1V5 (flat text); Q9X1V5 (good view)
DR GenBank; AAD36687
DR Pfam; PF02627; CMD;
DR Interpro; IPR004675; AhpD_dom;
DR Interpro; IPR003779; CMD;
DR PDB; 1P8C; Identical; 23-SEP-03; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1VKE; Identical; 08-JUN-04; CARBOXYMUCONOLACTONE DECARBOXYLASE FAMILY PROTEIN;
DR FFAS; 283477; Fold and function assignment.
DR TVPC; TM1620; Homologs in PDB, JCSG and SG center.
DR OVP; TM1620; Ortholog view popup.
DR TPM; TM1620; Target PDB monitor.
DR FSS; TM1620; Target function coverage.
PROPERTY Residues: 121 aa
Molecule Weight: 13788.25 Dalton
Isoelectric Point: 6.15
Extinction Coefficient: 4470
Gravy Index: -.17
Number of Met residues: 3
Percentage of Met residues: 2.48 %
Number of Cys residues: 3
Percentage of Cys residues: 2.48 %
SEQUENCE  amino acids 121 aa
>TM1620  TM1620 conserved hypothetical protein
MEYKKFVEARRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCD
DCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETIS
L

CDS  cDNA 363 bp
   1 gtggagtaca aaaagtttgt ggaagcaaga agagagctga acgagaaggt gttatcccgt    60
  61 ggaactctga acacgaagag attcttcaat ctcgactccg ccgtttacag gcccgggaaa   120
 121 ctcgatgtaa agaccaaaga actgatgggg ctcgtagcat ccacggttct caggtgcgat   180
 181 gattgtataa ggtaccacct tgtaaggtgt gttcaggaag gagcgagcga cgaagagatc   240
 241 ttcgaagccc ttgacatcgc cctcgtggtt ggtggctcta tcgtgatacc gcacttgaga   300
 301 agagctgtgg gattccttga agagctgagg gagatggaga aaaatggcga gactatttct   360
 361 ctt   363
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1608357 1608722 -3 Glimmer3 score 12.15 good
Genemark probabilities .8   .89 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu