LOADING...
   TM1612;TM1612
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1612    TM1612            JCSG 283469 PDB Deposition 07-SEP-13              PDB id: 2r9v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1612
DESCRIPTIONATP synthase alpha chain (EC 3.6.3.14)
ORGANISMThermotoga maritima
COMMENTGenome and functional context: on a chromosome this gene belongs to a conservative cluster (TM1609 - TM1616) of F0F1-type ATP synthase subunits genes.
--------------------------------------------------------------------
-!- FUNCTION: PRODUCES ATP FROM ADP IN THE PRESENCE OF A PROTON
GRADIENT ACROSS THE MEMBRANE. THE ALPHA CHAIN IS A REGULATORY
SUBUNIT (BY SIMILARITY).
-!- SUBUNIT: F-TYPE ATPASES HAVE 2 COMPONENTS, CF(1) - THE CATALYTIC
CORE - AND CF(0) - THE MEMBRANE PROTON CHANNEL. CF(1) HAS FIVE
SUBUNITS: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0)
HAS THREE MAIN SUBUNITS: A, B AND C (BY SIMILARITY).
-!- SIMILARITY: TO ATPASE ALPHA/BETA CHAINS FAMILY.
-!- SIMILARITY: TO ATP SYNTHASE ALPHA CHAIN, C TERMINUS.
DR UNIPROT; ATPA_THEMA
DR SPTR; Q9X1U7 (flat text); Q9X1U7 (good view)
DR GenBank; AAD36679
DR Pfam; PF00006; ATP-synt_ab;
DR Pfam; PF00306; ATP-synt_ab_C;
DR Pfam; PF02874; ATP-synt_ab_N;
DR Pfam; PF09378; HAS-barrel;
DR Interpro; IPR000793; ATPase_a/b_C;
DR Interpro; IPR000194; ATPase_a/bcentre;
DR Interpro; IPR004100; ATPase_a/bN;
DR Interpro; IPR000790; ATPase_a_C;
DR Interpro; IPR005294; ATP_synthF1_alph;
DR PDB; 2R9V; Identical; 02-OCT-07; ATP SYNTHASE SUBUNIT ALPHA;
DR PDB; 2QE7; Highly similar; 21-AUG-07; ATP SYNTHASE SUBUNIT ALPHA;
DR PDB; 1SKY; Highly similar; 04-MAR-98; F1-ATPASE;
DR PDB; 2XND; Highly similar; 15-SEP-10; ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIAL;
DR PDB; 1BMF; Highly similar; 07-DEC-96; BOVINE MITOCHONDRIAL F1-ATPASE;
DR PDB; 1NBM; Highly similar; 26-AUG-98; F1-ATPASE;
DR PDB; 1QO1; Highly similar; 04-NOV-99; ATP SYNTHASE ALPHA CHAIN;
DR PDB; 1E1Q; Highly similar; 28-JUN-00; BOVINE MITOCHONDRIAL F1-ATPASE;
DR KEGG; 3.6.1.34; Enzyme page
DR FFAS; 283469; Fold and function assignment.
DR TVPC; TM1612; Homologs in PDB, JCSG and SG center.
DR OVP; TM1612; Ortholog view popup.
DR TPM; TM1612; Target PDB monitor.
DR FSS; TM1612; Target function coverage.
PROPERTY Residues: 503 aa
Molecule Weight: 56058.8 Dalton
Isoelectric Point: 6.34
Extinction Coefficient: 31290
Gravy Index: -.18
Number of Met residues: 11
Percentage of Met residues: 2.19 %
Number of Cys residues: 2
Percentage of Cys residues: 0.40 %
SEQUENCE  amino acids 503 aa
>TM1612  TM1612 ATP synthase F1, subunit alpha (atpA)
MRINPGEITKVLEEKIKSFEEKIDLEDTGKVIQVGDGIARAYGLNKVMVSELVEFVETGV
KGVAFNLEEDNVGIIILGEYKDIKEGHTVRRLKRIIEVPVGEELLGRVVNPLGEPLDGKG
PINAKNFRPIEIKAPGVIYRKPVDTPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIA
IDTIINQKGQGVYCIYVAIGQKKSAIARIIDKLRQYGAMEYTTVVVASASDPASLQYIAP
YAGCAMGEYFAYSGRDALVVYDDLSKHAVAYRQLSLLMRRPPGREAYPGDIFYLHSRLLE
RAVRLNDKLGGGSLTALPIVETQANDISAYIPTNVISITDGQIYLEPGLFYAGQRPAINV
GLSVSRVGGSAQIKAMKQVAGMLRIDLAQYRELETFAQFATELDPATRAQIIRGQRLMEL
LKQEQYSPMPVEEQVVVLFAGVRGYLDDLPVEEVRRFEKEFLRFMHEKHQDILDDIKTKK
ELTSETEEKLKKAIEEFKTTFRV

CDS  cDNA 1509 bp
   1 ttgaggataa atcctggaga aatcacgaag gttctcgaag agaagataaa aagtttcgag    60
  61 gagaagatcg atctcgaaga cactggtaag gtcatccagg ttggagacgg tatagcccgt   120
 121 gcgtacgggt tgaataaagt gatggtgagt gagctcgtgg aattcgtcga aactggagtc   180
 181 aaaggagtcg ccttcaatct ggaagaggac aacgttggta tcatcatact cggtgaatac   240
 241 aaagatataa aagagggtca caccgtcaga agattgaaaa ggatcataga agtaccggtt   300
 301 ggagaagagc tcctcggtag ggtggtcaat ccgctcggag aaccgctcga tggaaagggc   360
 361 ccaataaacg caaagaactt cagaccgata gaaataaaag cccccggtgt catctacagg   420
 421 aaacccgtcg atacacctct ccagacagga ataaaggcga tcgactccat gattcccatc   480
 481 gggagaggcc aaagagagct gatcatagga gataggcaga cgggaaaaac ggccatcgct   540
 541 atagacacca tcatcaacca gaaaggacag ggtgtgtact gcatttacgt ggcgataggt   600
 601 cagaaaaagt ccgctattgc aaggatcatc gataaactca gacagtacgg agccatggag   660
 661 tacacaacgg tggttgtggc ctccgcttcc gacccggcat ctctccagta catagcaccg   720
 721 tacgcgggct gtgccatggg agagtacttc gcatattccg gaagggatgc cctcgtggtc   780
 781 tatgacgatc tttcgaagca cgccgtcgcc tacagacagc tctcacttct catgagaagg   840
 841 cccccgggaa gagaggctta tcctggggac atcttctatc tacactccag actccttgag   900
 901 agggccgtca gactgaacga caaactcggt ggaggatccc tcacggctct acccatcgtt   960
 961 gaaactcagg cgaacgatat atccgcctac attccaacga acgtgatatc catcactgac  1020
1021 ggtcagatat acctcgagcc cggattgttc tacgccggtc agagacctgc tatcaacgtt  1080
1081 ggtctgtccg tttccagggt tggaggatct gcgcagataa aagcaatgaa gcaggtcgcc  1140
1141 ggtatgttga gaattgatct tgcacagtac agagaactcg aaacgttcgc tcagtttgcc  1200
1201 acagaactgg atccagctac cagagcccag atcataagag gacagaggct catggaactt  1260
1261 ctgaaacagg aacagtacag tcctatgccc gttgaagagc aggtcgtcgt tctcttcgca  1320
1321 ggtgtcaggg gatacctcga tgatctcccg gtggaagaag tcagaagatt cgagaaggaa  1380
1381 tttctcagat ttatgcacga aaagcaccag gatatcctcg acgacataaa gacgaagaaa  1440
1441 gaactgactt cggaaacgga ggaaaaactc aagaaagcca ttgaagaatt caaaaccact  1500
1501 ttcagggtg  1509
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1600970 1602481 -2 Glimmer3 score 11.34 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu