LOADING...
   TM1602;TM1602
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1602    TM1602            JCSG 283459 PDB Deposition 02-JUL-05              PDB id: 1j5y

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1602
DESCRIPTIONTranscriptional regulator, biotin repressor family.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1T8_THEMA
DR SPTR; Q9X1T8 (flat text); Q9X1T8 (good view)
DR GenBank; AAD36669
DR Pfam; PF02829; 3H;
DR Pfam; PF08279; HTH_11;
DR Interpro; IPR004173; 3H;
DR PDB; 1J5Y; Identical; 31-JUL-02; TRANSCRIPTIONAL REGULATOR, BIOTIN REPRESSOR FAMIL CHAIN: A;
DR FFAS; 283459; Fold and function assignment.
DR TVPC; TM1602; Homologs in PDB, JCSG and SG center.
DR OVP; TM1602; Ortholog view popup.
DR TPM; TM1602; Target PDB monitor.
DR FSS; TM1602; Target function coverage.
PROPERTY Residues: 175 aa
Molecule Weight: 19553.78 Dalton
Isoelectric Point: 6.01
Extinction Coefficient: 5960
Gravy Index: -.09
Number of Met residues: 6
Percentage of Met residues: 3.43 %
Number of Cys residues: 1
Percentage of Cys residues: 0.57 %
SEQUENCE  amino acids 175 aa
>TM1602  TM1602 transcriptional regulator, biotin repressor family
MHMKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPR
GYVLAGGKSGVSRLVAVKHAPEEIKEELLCVVRNGGRIVDVIVEHPVYGEIRGIIDVSSE
EEVLKFVNLMEMAKTEPLLTLSGGVHLHTIEAPDEETMERIMRELKKKGFLIEEG

CDS  cDNA 525 bp
   1 atgcacatga aaaccgttag acaggaaaga ttgaagtcca tcgtaaggat tctcgagaga    60
  61 tcaaaagaac ctgtcagtgg agctcagctg gcagaagaac tcagtgtgag caggcaggtg   120
 121 atcgttcagg atatcgccta cttgagaagt cttggttaca acatcgtggc cacgccaagg   180
 181 ggatacgtgc ttgcgggtgg aaagtctgga gtctcgaggc ttgtagctgt gaagcacgcg   240
 241 ccagaagaga taaaagaaga attactctgt gtggtgagaa acggtggaag aatagtcgat   300
 301 gtgattgtgg aacatccggt ttacggtgaa ataagaggta tcatcgatgt ttcctccgag   360
 361 gaagaggtct tgaaatttgt aaacttgatg gagatggcaa agacagaacc tctcttaact   420
 421 ctctctggag gagttcatct tcacaccata gaggcaccgg atgaagaaac aatggaaaga   480
 481 atcatgagag agctgaagaa aaaaggtttc ctgatagagg aggga   525
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1592425 1592952 1 Glimmer3 score - -
Genemark probabilities .96   .81 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu