LOADING...
   TM1596;TM1596
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1596    TM1596            JCSG 283453 PDB Deposition 04-SEP-30              PDB id: 1vmk

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1596
DESCRIPTIONPurine nucleoside phosphorylase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1T2_THEMA
DR SPTR; Q9X1T2 (flat text); Q9X1T2 (good view)
DR GenBank; AAD36663
DR Pfam; PF01048; PNP_UDP_1;
DR Interpro; IPR001369; Mtap_PNP;
DR PDB; 1VMK; Identical; 12-OCT-04; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 3LA8; Highly similar; 12-JAN-11; PUTATIVE PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 3LBA; Highly similar; 12-JAN-11; PUTATIVE PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 3PHB; Highly similar; 09-NOV-11; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 1ULA; Highly similar; 15-JAN-93; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 1ULB; Highly similar; 15-JAN-93; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 1PF7; Highly similar; 01-JUN-04; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR PDB; 1RR6; Highly similar; 22-FEB-05; PURINE NUCLEOSIDE PHOSPHORYLASE;
DR FFAS; 283453; Fold and function assignment.
DR TVPC; TM1596; Homologs in PDB, JCSG and SG center.
DR OVP; TM1596; Ortholog view popup.
DR TPM; TM1596; Target PDB monitor.
DR FSS; TM1596; Target function coverage.
PROPERTY Residues: 265 aa
Molecule Weight: 29171.52 Dalton
Isoelectric Point: 6.67
Extinction Coefficient: 14440
Gravy Index: .05
Number of Met residues: 9
Percentage of Met residues: 3.40 %
Number of Cys residues: 2
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 265 aa
>TM1596  TM1596 purine nucleoside phosphorylase (deoD-1)
MMKKIEEARTFISERTNLSPDILIILGSGFGPFIEKVEDPVIIDYKDIPHFPQPTVEGHS
GKLVFGRISDKPVMIMAGRFHLYEGHDPATVAFPVYLAKYVGVKGVVVTNAAGAINPEFK
PGEIILVRDIINFMFRNPLRGPNDEKIGPRFPDMSSVVDPEWARKIQERLSLKEGVYIGV
LGPSYETPAEIRVFEKLGADLVGMSTVPEVIAAKHCGLKVVVFSCVTNMAAGITHGRLSH
EEVVRTTKMAQGKIEKALTTAVEVF

CDS  cDNA 795 bp
   1 atgatgaaaa agatcgaaga agcaaggacg tttataagtg aaagaacgaa cctttcaccg    60
  61 gacattttga tcatcctggg atccggtttt gggcctttca tagaaaaagt ggaagaccct   120
 121 gttattatag attataaaga tattcctcac ttcccacaac ctaccgtgga aggtcacagc   180
 181 gggaaactcg tttttggaag aataagcgat aagccagtta tgatcatggc aggaaggttt   240
 241 cacctttatg agggtcacga tccagcaacg gtggcttttc ccgtgtatct ggcaaaatac   300
 301 gtgggagtga aaggtgtcgt tgtaaccaac gccgccggtg cgataaaccc ggagttcaaa   360
 361 cctggagaaa tcattctggt gagagacata ataaacttca tgttcagaaa tcctctcaga   420
 421 ggtccaaacg acgaaaagat aggtccgagg tttcccgata tgtcctcggt tgttgatcct   480
 481 gaatgggcga ggaaaatcca ggaaagactc agcctgaagg aaggggttta catcggtgtc   540
 541 cttggaccaa gttacgagac gccagctgag atacgcgtct ttgaaaagct cggagctgat   600
 601 cttgttggga tgtcaaccgt tccagaagtg atcgctgcaa aacattgtgg actcaaagtg   660
 661 gttgtattct cctgtgtgac gaacatggca gccggtatca cccacggaag actgtcacac   720
 721 gaagaagtgg tgagaacaac gaaaatggca cagggtaaaa tagaaaaagc tctcaccact   780
 781 gcagtggagg tgttc   795
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1587130 1587927 -1 Glimmer3 score 13.46 good
Genemark probabilities .91   .62 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu