LOADING...
   TM1586;TM1586
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1586    TM1586            JCSG 359768 PDB Deposition 04-JUN-24              PDB id: 1vkw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1586
DESCRIPTIONPutative Nitroreductase (EC 1.-.-.-)
ORGANISMThermotoga maritima
COMMENT No genome context.
Psi-Blast: COG0778, NfnB, Nitroreductase [Energy production and conversion].
By sequence similarity - just a few homologs:
the closest one: Nitroreductase (EC 1.-.-.-) in Atopobium minutum.
DR UNIPROT; Q9X1S2_THEMA
DR SPTR; Q9X1S2 (flat text); Q9X1S2 (good view)
DR GenBank; AAD36653
DR PDB; 1VKW; Identical; 21-SEP-04; PUTATIVE NITROREDUCTASE;
DR KEGG; 1.; Enzyme page
DR FFAS; 283443; Fold and function assignment.
DR TVPC; TM1586; Homologs in PDB, JCSG and SG center.
DR OVP; TM1586; Ortholog view popup.
DR TPM; TM1586; Target PDB monitor.
DR FSS; TM1586; Target function coverage.
PROPERTY Residues: 206 aa
Molecule Weight: 24065.62 Dalton
Isoelectric Point: 7.7
Extinction Coefficient: 28420
Gravy Index: -.31
Number of Met residues: 4
Percentage of Met residues: 1.94 %
Number of Cys residues: 3
Percentage of Cys residues: 1.46 %
SEQUENCE  amino acids 206 aa
>TM1586  TM1586 hypothetical protein
MNIFEAIENRHSVRDFLERKMPERVKDDIENLLVKFITKKLDWKINLSSFPSYIYAKAEK
HFDELVEYGFQGEQIVLFLTAQGFGTCWMARSPHPDVPYIIVFGYPRTRNFTRKRRPITS
FLENDLEELPPEIVKIVEMTILAPSALNRQPWKIKYTGGELCISSERPVDLGIALSHAYL
TAREIFKREPVIQKRGEDTYCLILNP

CDS  cDNA 618 bp
   1 gtgaacatct ttgaagcgat tgaaaacagg cactcagtgc gggatttttt ggaaaggaaa    60
  61 atgccggaga gagtaaaaga tgatattgaa aatcttttag taaagtttat cacaaagaaa   120
 121 ctggactgga aaataaatct ttcctcattt ccaagttaca tttacgcaaa agctgaaaaa   180
 181 cattttgacg aactcgtcga atacggtttt cagggagaac aaatagtcct ttttctcaca   240
 241 gcgcagggtt ttggaacgtg ctggatggcc cgatcacccc atcctgatgt tccttacatc   300
 301 atcgtcttcg gatatcccag gaccagaaat ttcaccagaa agagaagacc catcacctcc   360
 361 tttctcgaaa acgacctgga agaacttcca cccgagatcg taaaaatcgt tgagatgacg   420
 421 atcctggcac cgtctgccct gaacagacag ccgtggaaaa tcaaatacac cggcggtgaa   480
 481 ctctgcatct cttcggaaag gcctgtagac ctgggaatag ccctgtcaca cgcgtacctc   540
 541 acagcccggg agatattcaa aagagaacct gtgatacaaa aaagagggga ggatacgtat   600
 601 tgtttgatcc tgaatcct   618
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1575118 1575738 -1 Glimmer3 score 8.12 poor
Genemark probabilities .67   .11 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu