LOADING...
   TM1585;TM1585
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1585    TM1585            JCSG 283442 PDB Deposition 05-OCT-07              PDB id: 2b8n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1585
DESCRIPTIONGlycerate kinase (EC 2.7.1.31)
ORGANISMThermotoga maritima
COMMENTGlycerate kinase participates in the final step
of Archaeal Entner-Doudoroff Pathway.
Genome and Functional Context: no chromosomal clustering is observed in the neighborhood of TM1585. Homologs of TM1585 in some other bacterial genomes (such as Pseudomonas putida) form a conserved cluster with genes encoding pyruvate kinase and a number of enzymes of glyoxylate metabolism.
A frequent alternative annotation of TM1585 homologs conserved in multiple bacterial genomes is “hydorxypyruvate reductase”.
Both functional roles utilize a common substrate (glycerate).
DR UNIPROT; Q9X1S1_THEMA
DR SPTR; Q9X1S1 (flat text); Q9X1S1 (good view)
DR GenBank; AAD36652
DR Pfam; PF05161; MOFRL;
DR Interpro; IPR007835; MOFRL;
DR PDB; 2B8N; Identical; 08-NOV-05; GLYCERATE KINASE, PUTATIVE;
DR PDB; 1X3L; Highly similar; 16-MAY-06; HYPOTHETICAL PROTEIN PH0495;
DR KEGG; 2.7.1.31; Enzyme page
DR FFAS; 283442; Fold and function assignment.
DR TVPC; TM1585; Homologs in PDB, JCSG and SG center.
DR OVP; TM1585; Ortholog view popup.
DR TPM; TM1585; Target PDB monitor.
DR FSS; TM1585; Target function coverage.
PROPERTY Residues: 417 aa
Molecule Weight: 44719.92 Dalton
Isoelectric Point: 5.73
Extinction Coefficient: 21430
Gravy Index: -.07
Number of Met residues: 4
Percentage of Met residues: 0.96 %
Number of Cys residues: 3
Percentage of Cys residues: 0.72 %
SEQUENCE  amino acids 417 aa
>TM1585  TM1585 glycerate kinase, putative
MFDPESLKKLAIEIVKKSIEAVFPDRAVKETLPKLNLDRVILVAVGKAAWRMAKAAYEVL
GKKIRKGVVVTKYGHSEGPIDDFEIYEAGHPVPDENTIKTTRRVLELVDQLNENDTVLFL
LSGGGSSLFELPLEGVSLEEIQKLTSALLKSGASIEEINTVRKHLSQVKGGRFAERVFPA
KVVALVLSDVLGDRLDVIASGPAWPDSSTSEDALKVLEKYGIETSESVKRAILQETPKHL
SNVEIHLIGNVQKVCDEAKSLAKEKGFNAEIITTSLDCEAREAGRFIASIMKEVKFKDRP
LKKPAALIFGGETVVHVKGNGIGGRNQELALSAAIALEGIEGVILCSAGTDGTDGPTDAA
GGIVDGSTAKTLKAMGEDPYQYLKNNDSYNALKKSGALLITGPTGTNVNDLIIGLIV

CDS  cDNA 1251 bp
   1 ttgtttgatc ctgaatcctt gaagaaatta gcgatagaaa tagtcaaaaa atccatagaa    60
  61 gcggtttttc ccgacagagc agtgaaagaa acgctgccga agttgaacct cgatcgagtg   120
 121 attctcgttg ccgttgggaa agcagcgtgg cgaatggcaa aagctgctta tgaagttctt   180
 181 gggaagaaga taagaaaagg tgtggttgta acaaagtacg gccacagcga aggaccgata   240
 241 gatgattttg aaatctacga ggcaggccat ccggttcccg atgaaaacac cataaaaacc   300
 301 accaggagag tcttagaact tgttgatcag ctgaatgaga acgacacagt cctttttctt   360
 361 ctttctggag gaggttcttc cctcttcgag ttgcctttag aaggagtgtc tctcgaagaa   420
 421 attcaaaaac taaccagcgc tctcttgaaa agtggtgcaa gcatagaaga gataaacacc   480
 481 gtgaggaaac acctgtcgca ggtgaaaggt ggtcgattcg cggagagggt gtttcccgct   540
 541 aaagtcgtag cgctcgtcct ctccgatgta ctcggtgaca gactggacgt gatagcatcc   600
 601 ggtcctgcct ggcctgatag ctccacctcc gaagacgctc tgaaagttct ggaaaagtac   660
 661 ggaatagaaa ccagcgaatc ggtgaaaaga gcgatccttc aggagactcc aaaacatcta   720
 721 tcgaacgtgg agatacattt gataggaaac gttcaaaagg tgtgtgacga agcgaagagt   780
 781 ttggcaaaag aaaaagggtt caacgcggag ataataacca cttctctgga ctgtgaagcc   840
 841 agagaagcgg gaagattcat agcgagcatc atgaaggagg tcaagttcaa agacagacct   900
 901 ctgaaaaaac cagccgcgtt gatcttcggt ggagaaacag tcgttcatgt gaaaggaaac   960
 961 ggcatcggag gaagaaacca agaacttgcc ctctcagcag cgatagccct cgaagggata  1020
1021 gaaggagtga ttctgtgttc agcaggaaca gatggaacgg acggccccac agacgcagct  1080
1081 ggaggaatcg tggatggaag cacggcaaaa acgctgaaag caatgggaga agacccctac  1140
1141 cagtatctga agaacaacga ttcgtacaac gctctgaaaa aatctggagc gctcttgata  1200
1201 acaggaccta cgggaacgaa cgtcaacgac ttgataatag gcctcatcgt c  1251
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1573886 1575139 -2 Glimmer3 score 14.39 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu