LOADING...
   TM1561;TM1561
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1561    TM1561            JCSG 283418 PDB Deposition 05-AUG-23              PDB id: 2ash

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1561
DESCRIPTIONQueuine tRNA-ribosyltransferase (EC 2.4.2.29) (tRNA-guanine transglycosylase) (Guanine insertion enzyme).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: EXCHANGES THE GUANINE RESIDUE WITH 7-AMINOMETHYL-7-
DEAZAGUANINE IN TRNAS WITH GU(N) ANTICODONS (TRNA-ASP, -ASN, -HIS
AND -TYR). AFTER THIS EXCHANGE, A CYCLOPENTENDIOL MOIETY IS
ATTACHED TO THE 7-AMINOMETHYL GROUP OF 7-DEAZAGUANINE, RESULTING
IN THE HYPERMODIFIED NUCLEOSIDE QUEUOSINE (Q) (7-(((4,5-CIS-
DIHYDROXY-2-CYCLOPENTEN-1-YL)AMINO)METHYL)-7-DEAZAGUANOSINE) (BY
SIMILARITY).
-!- CATALYTIC ACTIVITY: TRNA GUANINE + QUEUINE = TRNA QUEUINE +
GUANINE.
-!- COFACTOR: BINDS 1 ZINC ION PER SUBUNIT (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE QUEUINE TRNA-RIBOSYLTRANSFERASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; TGT_THEMA
DR SPTR; Q9X1P7 (flat text); Q9X1P7 (good view)
DR GenBank; AAD36627
DR Pfam; PF01702; TGT;
DR Interpro; IPR004803; QtRNA_ribo_trans;
DR Interpro; IPR002616; tRNA_ribo_trans;
DR PDB; 2ASH; Identical; 06-SEP-05; QUEUINE TRNA-RIBOSYLTRANSFERASE;
DR PDB; 1OZM; Highly similar; 30-SEP-03; QUEUINE TRNA-RIBOSYLTRANSFERASE;
DR PDB; 1OZQ; Highly similar; 30-SEP-03; QUEUINE TRNA-RIBOSYLTRANSFERASE;
DR PDB; 4IPP; Highly similar; 15-JAN-14; QUEUINE TRNA-RIBOSYLTRANSFERASE;
DR PDB; 1PUD; Highly similar; 07-JUL-97; TRNA-GUANINE TRANSGLYCOSYLASE;
DR PDB; 1ENU; Highly similar; 19-APR-00; TRNA-GUANINE TRANSGLYCOSYLASE;
DR PDB; 1F3E; Highly similar; 15-JUN-00; QUEUINE TRNA-RIBOSYLTRANSFERASE;
DR PDB; 1K4G; Highly similar; 24-APR-02; TRNA-GUANINE TRANSGLYCOSYLASE;
DR KEGG; 2.4.2.29; Enzyme page
DR FFAS; 283418; Fold and function assignment.
DR TVPC; TM1561; Homologs in PDB, JCSG and SG center.
DR OVP; TM1561; Ortholog view popup.
DR TPM; TM1561; Target PDB monitor.
DR FSS; TM1561; Target function coverage.
PROPERTY Residues: 369 aa
Molecule Weight: 41426.68 Dalton
Isoelectric Point: 6.39
Extinction Coefficient: 29910
Gravy Index: -.14
Number of Met residues: 12
Percentage of Met residues: 3.25 %
Number of Cys residues: 5
Percentage of Cys residues: 1.36 %
SEQUENCE  amino acids 369 aa
>TM1561  TM1561 tRNA guanine transglycosylase (tgt)
MEFEVKKTFGKARLGVMKLHHGAVETPVFMPVGTNASVKLLTPRDLEEAGAEIILSNTFH
LMLKPGVEIIKLHRGLHNFMGWKRPILTDSGGFQVFSLPKIRIDDEGVVFRSPIDGSKVF
LNPEISMEVQIALGSDICMVFDHCPVPDADYEEVKEATERTYRWALRSKKAFKTENQALF
GIVQGGIYPDLRRESALQLTSIGFDGYAIGGLSIGEERSLTLEMTEVTVEFLPEDKPRYF
MGGGSPELILELVDRGVDMFDSVFPTRIARHGTALTWNGKLNLKASYNKRSLEPVDERCG
CYTCKNFTRSYIHHLFDRGEVLGQILLTIHNINFMISLMKEVRRSIESGTFKELKSKVVE
VYSSGGVNV

CDS  cDNA 1107 bp
   1 gtggagttcg aagtgaaaaa aactttcgga aaagcaagac tgggtgtcat gaagcttcac    60
  61 cacggagctg ttgaaactcc tgttttcatg ccggttggaa ccaacgcgag cgtgaagctt   120
 121 ctcactccca gagatctgga agaagcagga gcggagataa ttctttcgaa cacgtttcat   180
 181 ctcatgttga aacccggtgt ggagatcata aagcttcaca ggggacttca caacttcatg   240
 241 ggatggaaaa gaccgatact caccgacagc ggaggttttc aagttttcag ccttccaaag   300
 301 atcaggatag acgatgaagg tgtggtcttc agatctccta ttgacggttc gaaagttttc   360
 361 ctgaatccag agatatccat ggaggttcag atcgctctgg gatcggatat ctgcatggtc   420
 421 ttcgatcact gtcctgtacc cgatgccgat tacgaagagg tgaaagaggc aacagagaga   480
 481 acctatcgat gggctctgag atctaaaaag gctttcaaaa cggagaatca agcactcttt   540
 541 ggaatcgttc agggagggat ctacccggat ctgcggagag aaagcgctct tcagcttaca   600
 601 tcgattggat tcgatggata cgccatagga ggattgagca taggtgaaga aagatccctc   660
 661 actcttgaaa tgaccgaagt cacggtggag tttcttccgg aagataaacc ccgttacttc   720
 721 atgggaggag ggtctccaga actcatactc gagctcgttg atcgaggagt ggatatgttc   780
 781 gacagcgtct tcccaaccag gatagcaagg cacggaactg cgctcacctg gaatgggaaa   840
 841 ctcaacctca aggcctctta caacaagcgg tccctcgaac cggtggacga aaggtgcggg   900
 901 tgttatacct gcaagaattt cacgcggtct tacatccatc acctcttcga tcgaggagaa   960
 961 gtccttgggc agatactcct cacgattcac aacatcaact tcatgatctc tctaatgaag  1020
1021 gaagtaaggc gttctataga gagtggaacc ttcaaggaac tgaaaagcaa agtggtagaa  1080
1081 gtctattctt cagggggtgt gaatgta  1107
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1551840 1552949 3 Glimmer3 score 9.25 poor
Genemark probabilities .84   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu