LOADING...
   TM1560;TM1560
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1560    TM1560            JCSG 283417 PDB Deposition 03-SEP-17              PDB id: 1o5h

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1560
DESCRIPTIONFormiminotetrahydrofolate cyclodeaminase (EC 4.3.1.4)
ORGANISMThermotoga maritima
COMMENT This enzyme is involved in folate metabolism, converting 5-formimidoyltetrahydrofolate to 5,10-methenyltetrahydrofolate. In eukaryotes it forms a bi-functional fusion protein with Glutamate formiminotransferase (EC 2.1.2.5) domain, catalyzing the previous step in the pathway (from tetrahydrofolate to formiminotetrahydrofolate). In T.maritima Glutamate formiminotransferase (EC 2.1.2.5) is encoded by the separate gene (TM0843).
Genome context: indirect functional coupling. Close homologs of TM1560 are consistently clustered in various bacterial genomes with the enzymes involved with folate metabolism. For example the cluster in Clostridium tetani and Thermoplasma volcani contains genes encoding Glutamate formiminotransferase (EC 2.1.2.5) and Formate-tetrahydrofolate ligase (EC 6.3.4.3).
Functional context: In addition to enzymes mentioned above, T.maritima contains several other genes encoding enzymes involved in single carbon transfer reactions by folate ( KEGG MAP 00670 ). These enzymes include components of metabolism of methionine, purines, pantothenate, glycine and serine
DR UNIPROT; Q9X1P6_THEMA
DR SPTR; Q9X1P6 (flat text); Q9X1P6 (good view)
DR GenBank; AAD36626
DR Pfam; PF04961; FTCD_C;
DR Interpro; IPR007044; FTCD_C;
DR PDB; 1O5H; Identical; 30-SEP-03; FORMIMINOTETRAHYDROFOLATE CYCLODEAMINASE;
DR KEGG; 4.3.1.4; Enzyme page
DR FFAS; 283417; Fold and function assignment.
DR TVPC; TM1560; Homologs in PDB, JCSG and SG center.
DR OVP; TM1560; Ortholog view popup.
DR TPM; TM1560; Target PDB monitor.
DR FSS; TM1560; Target function coverage.
PROPERTY Residues: 202 aa
Molecule Weight: 22712.09 Dalton
Isoelectric Point: 4.96
Extinction Coefficient: 9970
Gravy Index: -.33
Number of Met residues: 12
Percentage of Met residues: 5.94 %
Number of Cys residues: 4
Percentage of Cys residues: 1.98 %
SEQUENCE  amino acids 202 aa
>TM1560  TM1560 serine cycle enzyme, putative
MEVERLSLKEFCDMVAERKPTPGGGAVGSVVGAMACALAEMVANFTRKKKGYEDVEPEME
RIVEAMEEARLKLFDLAKKDMEAFEKVMKAYKSSEGELQNALKEAASVPMDVIRVMKDLA
HELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLKEISDETFRKNMLEELEEQE
AQIEGCYQRVKKMLEGIVWSSK

CDS  cDNA 606 bp
   1 atggaggttg aacgcctttc gctcaaagaa ttctgcgata tggttgcaga gagaaagcca    60
  61 actcctggtg ggggagcggt tggatcagtc gtgggagcca tggcatgtgc cctcgctgaa   120
 121 atggttgcga atttcaccag gaagaaaaag ggttacgaag atgtggaacc ggagatggag   180
 181 aggatagttg aggcaatgga agaagcgaga ctgaaactct tcgatcttgc aaagaaagac   240
 241 atggaagcct ttgaaaaggt catgaaagct tacaaatcct ctgaaggaga gcttcagaat   300
 301 gctctgaagg aagctgcttc tgtaccgatg gacgtgataa gggtgatgaa agacctcgca   360
 361 cacgagctcg agaagctcgc cgaatttgga aacaagaatc tggcatcgga cacgttgaac   420
 421 gccgcagatc tctgccacgc ggtctttcag gttgagaagg tgaacgttct gatcaatttg   480
 481 aaagagattt cagacgagac tttcaggaaa aacatgctgg aagagctcga agaacaggaa   540
 541 gcacagattg aaggctgtta tcaaagggtg aagaagatgc tggagggaat cgtgtggagt   600
 601 tcgaag   606
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1551247 1551855 1 Glimmer3 score 14.07 good
Genemark probabilities .89   .66 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu