LOADING...
   TM1559;TM1559
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1559    TM1559            JCSG 283416 PDB Deposition 11-MAR-09              PDB id: 3r13, 3r12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1559
DESCRIPTIONDeoxyribose-phosphate aldolase (EC 4.1.2.4) (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: 2-DEOXY-D-RIBOSE 5-PHOSPHATE = D-
GLYCERALDEHYDE 3-PHOSPHATE + ACETALDEHYDE.
-!- PATHWAY: NUCLEOTIDE AND DEOXYRIBONUCLEOTIDE CATABOLISM.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE DEOC/FBAB FAMILY OF ALDOLASES. DEOC
SUBFAMILY 1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; DEOC_THEMA
DR SPTR; Q9X1P5 (flat text); Q9X1P5 (good view)
DR GenBank; AAD36625
DR Pfam; PF01791; DeoC;
DR Interpro; IPR002915; DeoC;
DR Interpro; IPR003009; FMN_enzyme;
DR PDB; 3R13; Identical; 30-MAR-11; DEOXYRIBOSE-PHOSPHATE ALDOLASE;
DR PDB; 3R12; Identical; 20-APR-11; DEOXYRIBOSE-PHOSPHATE ALDOLASE;
DR PDB; 3NGJ; Highly similar; 21-JUL-10; DEOXYRIBOSE-PHOSPHATE ALDOLASE;
DR PDB; 3OA3; Highly similar; 18-AUG-10; ALDOLASE;
DR PDB; 1MZH; Highly similar; 04-FEB-03; DEOXYRIBOSE-PHOSPHATE ALDOLASE;
DR PDB; 1J2W; Highly similar; 08-APR-03; ALDOLASE PROTEIN;
DR PDB; 1UB3; Highly similar; 08-APR-03; ALDOLASE PROTEIN;
DR PDB; 3NDO; Highly similar; 21-JUL-10; DEOXYRIBOSE-PHOSPHATE ALDOLASE;
DR KEGG; 4.1.2.4; Enzyme page
DR FFAS; 283416; Fold and function assignment.
DR TVPC; TM1559; Homologs in PDB, JCSG and SG center.
DR OVP; TM1559; Ortholog view popup.
DR TPM; TM1559; Target PDB monitor.
DR FSS; TM1559; Target function coverage.
PROPERTY Residues: 248 aa
Molecule Weight: 27283.87 Dalton
Isoelectric Point: 5.24
Extinction Coefficient: 24410
Gravy Index: -.13
Number of Met residues: 7
Percentage of Met residues: 2.82 %
Number of Cys residues: 5
Percentage of Cys residues: 2.02 %
SEQUENCE  amino acids 248 aa
>TM1559  TM1559 deoxyribose-phosphate aldolase (deoC)
MIEYRIEEAVAKYREFYEFKPVRESAGIEDVKSAIEHTNLKPFATPDDIKKLCLEARENR
FHGVCVNPCYVKLAREELEGTDVKVVTVVGFPLGANETRTKAHEAIFAVESGADEIDMVI
NVGMLKAKEWEYVYEDIRSVVESVKGKVVKVIIETCYLDTEEKIAACVISKLAGAHFVKT
STGFGTGGATAEDVHLMKWIVGDEMGVKASGGIRTFEDAVKMIMYGADRIGTSSGVKIVQ
GGEERYGG

CDS  cDNA 744 bp
   1 atgatagagt acaggattga ggaggcagta gcgaagtaca gagagttcta cgaattcaag    60
  61 cccgtcagag aaagcgcagg tattgaagat gtgaaaagtg ctatagagca cacgaatctg   120
 121 aaaccgtttg ccacaccaga cgatataaaa aaactctgtc ttgaagcaag ggaaaatcgt   180
 181 ttccatggag tctgtgtgaa tccgtgttat gtgaaactgg ctcgtgaaga actcgaagga   240
 241 accgatgtga aagtcgtcac cgttgttggt tttccactgg gagcgaacga aactcggacg   300
 301 aaagcccatg aggcgatttt cgctgttgag agtggagccg atgagatcga tatggtcatc   360
 361 aacgttggca tgctcaaggc aaaggagtgg gagtacgttt acgaggatat aagaagtgtt   420
 421 gtcgaatcgg tgaaaggaaa agttgtgaag gtgatcatcg aaacgtgcta tctggatacg   480
 481 gaagagaaga tagcggcgtg tgtcatttcc aaacttgctg gagctcattt cgtgaagact   540
 541 tccacgggat ttggaacagg aggggcgacc gcagaagacg ttcatctcat gaaatggatc   600
 601 gtgggagatg agatgggtgt aaaagcttcc ggagggatca gaaccttcga ggacgctgtt   660
 661 aaaatgatca tgtacggtgc tgatagaata ggaacgagtt cgggagttaa gatcgttcag   720
 721 gggggagaag agagatatgg aggt   744
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1550511 1551257 3 Glimmer3 score 11.97 poor
Genemark probabilities .91   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu