LOADING...
   TM1553;TM1553
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1553    TM1553            JCSG 358474 PDB Deposition 05-MAR-10              PDB id: 1vrm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1553
DESCRIPTIONApbE protein involved in thiamine biosynthesis
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1N9_THEMA
DR SPTR; Q9X1N9 (flat text); Q9X1N9 (good view)
DR GenBank; AAD36619
DR Pfam; PF02424; ApbE;
DR Interpro; IPR003374; ApbE;
DR PDB; 1VRM; Identical; 22-MAR-05; HYPOTHETICAL PROTEIN TM1553;
DR PDB; 4IFU; Highly similar; 27-FEB-13; THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE;
DR PDB; 4IFW; Highly similar; 27-FEB-13; THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE;
DR PDB; 4IFX; Highly similar; 27-FEB-13; THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE;
DR PDB; 4IFZ; Highly similar; 27-FEB-13; THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE;
DR PDB; 4IG1; Highly similar; 27-FEB-13; THIAMINE BIOSYNTHESIS LIPOPROTEIN APBE;
DR FFAS; 283410; Fold and function assignment.
DR TVPC; TM1553; Homologs in PDB, JCSG and SG center.
DR OVP; TM1553; Ortholog view popup.
DR TPM; TM1553; Target PDB monitor.
DR FSS; TM1553; Target function coverage.
PROPERTY Residues: 352 aa
Molecule Weight: 39540.02 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 53860
Gravy Index: -.15
Number of Met residues: 7
Percentage of Met residues: 1.99 %
Number of Cys residues: 1
Percentage of Cys residues: 0.28 %
SEQUENCE  amino acids 352 aa
>TM1553  TM1553 conserved hypothetical protein
MHKMWPSDSNDHRVTRRNVIIFSSLLLGSLAILLALLLIRTKDQYYELRDFALGTSVRIV
VSSQKINPRTIAEAILEDMKRITYKFSFTDERSVVKKINDHPNEWVEVDEETYSLIKAAC
AFAELTDGAFDPTVGRLLELWGFTGNYENLRVPSREEIEEALKHTGYKNVLFDDKNMRVM
VKNGVKIDLGGIAKGYALDRARQIALSFDENATGFVEAGGDVRIIGPKFGKYPWVIGVKD
PRGDDVIDYIYLKSGAVATSGDYERYFVVDGVRYHHILDPSTGYPARGVWSVTIIAEDAT
TADALSTAGFVMAGKDWRKVVLDFPNMGAHLLIVLEGGAIERSETFKLFERE

CDS  cDNA 1056 bp
   1 gtgcacaaaa tgtggccgtc agatagcaac gatcatcggg taaccagaag aaacgtcatc    60
  61 atcttttctt cacttcttct aggttctctt gcgattctct tggctttact cctcatccga   120
 121 acgaaagatc agtattatga gctcagagat ttcgctctcg gaacgagtgt gaggatagtc   180
 181 gtttcctctc agaagataaa tcccagaacg atcgcagaag ccattctgga agacatgaag   240
 241 aggattacct acaagttttc tttcacggat gaaagaagtg ttgtgaaaaa gataaacgat   300
 301 catcccaacg aatgggtcga ggtggacgaa gagacttaca gtttgatcaa agcggcctgc   360
 361 gcgttcgcag agctcacaga tggagcgttt gatccgacag taggaaggct tctcgaactc   420
 421 tgggggttta ccgggaacta cgaaaatctc agggtacctt ctcgggaaga gatcgaagag   480
 481 gctctgaagc ataccgggta taaaaacgtt ctcttcgacg ataagaacat gagagtgatg   540
 541 gttaaaaacg gtgtgaagat cgatcttggt ggtatagcga agggatacgc cctcgacagg   600
 601 gccagacaga tagcactctc ttttgatgag aacgcaacgg ggtttgtcga agcaggtgga   660
 661 gatgttcgta tcatcgggcc aaagttcgga aagtatccgt gggtgatagg agtaaaagat   720
 721 cccaggggag acgatgtgat agattacatc tatctgaaat ctggagcggt tgcgacttcc   780
 781 ggtgattacg aaagatattt cgttgtggac ggtgtcaggt atcatcatat tctcgatcct   840
 841 tcaacagggt atcctgctcg tggtgtgtgg agcgtaacga tcatagccga agatgccacc   900
 901 acagccgacg cactctccac agcgggcttt gtgatggccg gaaaagactg gagaaaagtg   960
 961 gtgctcgatt ttccaaatat gggagctcat ctgctgatag ttcttgaagg aggagcgatc  1020
1021 gaaaggtctg agaccttcaa gctgttcgaa agagag  1056
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1546865 1547923 2 Glimmer3 score - -
Genemark probabilities .87   .01 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu