LOADING...
   TM1526;TM1526
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1526    TM1526            JCSG 283383 PDB Deposition 04-APR-01              PDB id: 1vjx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1526
DESCRIPTIONPutative ferritin-like diiron-carboxylate protein
ORGANISMThermotoga maritima
COMMENT No genome context.
Pfam: Ferritin-like domain found in Archaea and Bacteria (Ferritin_like_AB) is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins.The conserved residues of a diiron center are present in this uncharacterized domain. CD: cd01045.1, Ferritin_like_AB
DR UNIPROT; Q9X1L2_THEMA
DR SPTR; Q9X1L2 (flat text); Q9X1L2 (good view)
DR GenBank; AAD36593
DR Pfam; PF02915; Rubrerythrin;
DR PDB; 1VJX; Identical; 13-APR-04; PUTATIVE FERRITIN-LIKE DIIRON-CARBOXYLATE PROTEIN CHAIN: A;
DR FFAS; 283383; Fold and function assignment.
DR TVPC; TM1526; Homologs in PDB, JCSG and SG center.
DR OVP; TM1526; Ortholog view popup.
DR TPM; TM1526; Target PDB monitor.
DR FSS; TM1526; Target function coverage.
PROPERTY Residues: 145 aa
Molecule Weight: 17192.62 Dalton
Isoelectric Point: 4.88
Extinction Coefficient: 14440
Gravy Index: -.6
Number of Met residues: 3
Percentage of Met residues: 2.07 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 145 aa
>TM1526  TM1526 hypothetical protein
MKVSDILTVAIRLEEEGERFYRELSEHFNGEIKKTFLELADQERIHAEIFRKMSDQENWD
EVDSYLAGYAFYEVFPDTSEILRRKDLTLKEVLDIAISVEKDSIILYYELKDGLVNSDAQ
KTVKKIIDQEKEHLRKLLEMKREST

CDS  cDNA 435 bp
   1 atgaaagtaa gcgacattct gacagtggcc atcaggctgg aagaggaagg cgaaagattc    60
  61 tacagggaac tatcagaaca ttttaatgga gagataaaga agactttcct tgagcttgcc   120
 121 gatcaggaaa ggattcatgc ggaaatcttt agaaagatgt cagaccagga aaactgggat   180
 181 gaggtggatt cttatctcgc gggatacgct ttctatgaag tttttcctga cacgagtgaa   240
 241 attttaagga gaaaggatct aaccttgaaa gaggttctgg atatagccat atccgttgaa   300
 301 aaagacagca taattctcta ctatgaactc aaagatggtc ttgtgaattc cgatgcacag   360
 361 aaaacagtga aaaagatcat cgatcaggaa aaagaacatc taagaaagct tctcgagatg   420
 421 aaacgtgaaa gtacc   435
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1522327 1522764 1 Glimmer3 score 11.54 poor
Genemark probabilities .83   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu