LOADING...
   TM1521;TM1521
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1521    TM1521            JCSG 283378 PDB Deposition 03-SEP-22              PDB id: 1o5k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1521
DESCRIPTIONDihydrodipicolinate synthase (EC 4.2.1.52) (DHDPS).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: L-ASPARTATE 4-SEMIALDEHYDE + PYRUVATE =
DIHYDRODIPICOLINATE + 2 H(2)O.
-!- PATHWAY: BIOSYNTHESIS OF DIAMINOPIMELATE AND LYSINE FROM ASPARTATE
SEMIALDEHYDE; FIRST STEP.
-!- SUBUNIT: HOMOTETRAMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE DHDPS FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; DAPA_THEMA
DR SPTR; Q9X1K9 (flat text); Q9X1K9 (good view)
DR GenBank; AAD36588
DR Pfam; PF00701; DHDPS;
DR Interpro; IPR005263; DapA_synth;
DR Interpro; IPR002220; DHDPS;
DR Interpro; IPR003009; FMN_enzyme;
DR PDB; 1O5K; Identical; 07-OCT-03; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3PB2; Identical; 23-NOV-11; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3PB0; Identical; 23-NOV-11; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 2YXG; Highly similar; 30-OCT-07; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3PUD; Highly similar; 22-DEC-10; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3PUE; Highly similar; 22-DEC-10; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3PUL; Highly similar; 29-DEC-10; DIHYDRODIPICOLINATE SYNTHASE;
DR PDB; 3RK8; Highly similar; 27-APR-11; DIHYDRODIPICOLINATE SYNTHASE;
DR KEGG; 4.2.1.52; Enzyme page
DR FFAS; 283378; Fold and function assignment.
DR TVPC; TM1521; Homologs in PDB, JCSG and SG center.
DR OVP; TM1521; Ortholog view popup.
DR TPM; TM1521; Target PDB monitor.
DR FSS; TM1521; Target function coverage.
PROPERTY Residues: 294 aa
Molecule Weight: 32388.59 Dalton
Isoelectric Point: 5.91
Extinction Coefficient: 20400
Gravy Index: -.14
Number of Met residues: 5
Percentage of Met residues: 1.70 %
Number of Cys residues: 2
Percentage of Cys residues: 0.68 %
SEQUENCE  amino acids 294 aa
>TM1521  TM1521 dihydrodipicolinate synthase (dapA)
MFRGVGTAIVTPFKNGELDLESYERLVRYQLENGVNALIVLGTTGESPTVNEDEREKLVS
RTLEIVDGKIPVIVGAGTNSTEKTLKLVKQAEKLGANGVLVVTPYYNKPTQEGLYQHYKY
ISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANPDIDQIDRTVSLTKQA
RSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYFSGNLEKSREVHRKLR
PLMKALFVETNPIPVKAALNLMGFIENELRLPLVPASEKTVELLRNVLKESGLL

CDS  cDNA 882 bp
   1 atgttcagag gagtaggaac tgctatcgtt acaccattca aaaatggtga gcttgatctt    60
  61 gagtcttacg agaggcttgt caggtatcag ctcgaaaacg gcgtcaacgc gttgatcgtc   120
 121 cttggaacga caggtgaatc accaaccgtc aacgaagacg agagagaaaa gctcgtttcc   180
 181 agaactctcg agatcgtcga tgggaaaatc cctgtgatcg tgggagcggg aacgaattcc   240
 241 accgaaaaaa cgctgaaact cgtcaagcag gcggaaaaac tcggagcgaa cggagttctt   300
 301 gtggtcaccc cgtattacaa caagcccaca caggaaggac tctatcagca ctacaagtac   360
 361 atctctgaga gaacggatct cgggatcgtt gtttacaacg tgcccggaag aaccggtgtg   420
 421 aacgttctcc cggaaactgc tgcaaggatc gctgcggacc tcaagaacgt ggtgggaata   480
 481 aaagaggcga acccggatat agaccagata gacaggacgg tatcactgac aaaacaggca   540
 541 agaagcgatt tcatggtgtg gtccggcaac gatgatagaa cgttctatct cctctgcgcg   600
 601 ggtggagacg gcgtcatctc tgttgtgtcg aacgtggcac cgaaacagat ggtagaactc   660
 661 tgcgcagagt acttcagcgg aaacctcgaa aaatcgaggg aggttcacag aaaactcaga   720
 721 cctctcatga aggcactgtt cgtggaaaca aatccgatac cagttaaagc cgctttgaat   780
 781 ctcatgggat tcatcgagaa cgagctgaga ctaccgcttg tacctgccag tgaaaagacg   840
 841 gtggaacttc tcagaaacgt tctcaaggag agtggattgc ta   882
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1516424 1517308 -2 Glimmer3 score 13.68 good
Genemark probabilities .92   .38 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu