LOADING...
   TM1520;TM1520
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1520    TM1520            JCSG 283377 PDB Deposition 04-SEP-03              PDB id: 1vm6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1520
DESCRIPTIONDihydrodipicolinate reductase (EC 1.3.1.26) (DHPR).
ORGANISMThermotoga maritima
COMMENTGenome and functional context very supportive: This enzyme belongs to very strong cluster of Lysine Biosynthesis Subsystem (TM1516 -TM TM1523):
TM1516 - N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.18),
TM1517 - Diaminopimelate decarboxylase (EC 4.1.1.20),
TM1518 - Aspartokinase (EC 2.7.2.4),
TM1519 - 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (EC 2.3.1.89),
TM1521 - Dihydrodipicolinate synthase (EC 4.2.1.52),
TM1522 - Diaminopimelate epimerase (EC 5.1.1.7),
TM1523 - Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11).
--------------------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: 2,3,4,5-TETRAHYDRODIPICOLINATE + NAD(P)(+) =
2,3-DIHYDRODIPICOLINATE + NAD(P)H.
-!- PATHWAY: BIOSYNTHESIS OF DIAMINOPIMELATE AND LYSINE FROM ASPARTATE
SEMIALDEHYDE; SECOND STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE DIHYDRODIPICOLINATE REDUCTASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; DAPB_THEMA
DR SPTR; Q9X1K8 (flat text); Q9X1K8 (good view)
DR GenBank; AAD36587
DR Pfam; PF05173; DapB_C;
DR Pfam; PF01113; DapB_N;
DR Interpro; IPR000846; DapB;
DR PDB; 1VM6; Identical; 21-SEP-04; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 4YWJ; Highly similar; 01-APR-15; 4-HYDROXY-TETRAHYDRODIPICOLINATE REDUCTASE;
DR PDB; 3QY9; Highly similar; 03-AUG-11; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 4F3Y; Highly similar; 06-JUN-12; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 1DIH; Highly similar; 15-SEP-95; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 1DRU; Highly similar; 27-JAN-97; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 1DRV; Highly similar; 27-JAN-97; DIHYDRODIPICOLINATE REDUCTASE;
DR PDB; 1DRW; Highly similar; 27-JAN-97; DIHYDRODIPICOLINATE REDUCTASE;
DR KEGG; 1.3.1.26; Enzyme page
DR FFAS; 283377; Fold and function assignment.
DR TVPC; TM1520; Homologs in PDB, JCSG and SG center.
DR OVP; TM1520; Ortholog view popup.
DR TPM; TM1520; Target PDB monitor.
DR FSS; TM1520; Target function coverage.
PROPERTY Residues: 216 aa
Molecule Weight: 23730.22 Dalton
Isoelectric Point: 5.7
Extinction Coefficient: 12950
Gravy Index: .04
Number of Met residues: 4
Percentage of Met residues: 1.85 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 216 aa
>TM1520  TM1520 dihydrodipicolinate reductase (dapB)
MKYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDL
CKKYRAGLVLGTTALKEEHLQMLRELSKEVPVVQAYNFSIGINVLKRFLSELVKVLEDWD
VEIVETHHRFKKDAPSGTAILLESALGKSVPIHSLRVGGVPGDHVVVFGNIGETIEIKHR
AISRTVFAIGALKAAEFLVGKDPGMYSFEEVIFGGE

CDS  cDNA 648 bp
   1 atgaagtacg gaatagtcgg ttattccgga aggatgggcc aggagatcca gaaggtcttc    60
  61 tcggagaaag ggcatgaact cgttttgaag gtggatgtga acggtgtcga ggagctggat   120
 121 tctccggatg ttgtgatcga cttttcttca cctgaagcgc ttccgaaaac ggtggatctg   180
 181 tgtaaaaaat acagggctgg cctcgttctg ggaacaactg ccctgaaaga agaacatctc   240
 241 cagatgttga gggagctttc gaaagaagta cccgttgttc aggcttacaa cttctccatt   300
 301 ggcataaacg ttctgaagag gttcctctcg gaactcgtca aagtcctcga agattgggat   360
 361 gttgagatcg tggagacgca ccaccgcttc aaaaaggacg caccctccgg aaccgcgatt   420
 421 cttctggaga gcgcactggg aaagagtgtt cccattcact cgctgagagt gggtggtgtt   480
 481 ccgggagatc acgtggtcgt ttttggaaac ataggtgaga cgatcgagat aaagcacagg   540
 541 gcgatttcga ggactgtttt cgccatagga gccctgaaag cggcggagtt tcttgtggga   600
 601 aaagatcccg gtatgtacag tttcgaagaa gtgatctttg gaggtgag   648
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1515777 1516427 -3 Glimmer3 score 15.02 good
Genemark probabilities .93   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu