LOADING...
   TM1506;TM1506
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1506    TM1506            JCSG 283363 PDB Deposition 04-MAY-06              PDB id: 1vk9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1506
DESCRIPTIONADP-ribosylated protein with unknown function
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1J4_THEMA
DR SPTR; Q9X1J4 (flat text); Q9X1J4 (good view)
DR GenBank; AAD36573
DR Pfam; PF08973; TM1506;
DR PDB; 1VK9; Identical; 18-MAY-04; CONSERVED HYPOTHETICAL PROTEIN TM1506;
DR FFAS; 283363; Fold and function assignment.
DR TVPC; TM1506; Homologs in PDB, JCSG and SG center.
DR OVP; TM1506; Ortholog view popup.
DR TPM; TM1506; Target PDB monitor.
DR FSS; TM1506; Target function coverage.
PROPERTY Residues: 139 aa
Molecule Weight: 15743.74 Dalton
Isoelectric Point: 8.89
Extinction Coefficient: 4470
Gravy Index: -.11
Number of Met residues: 6
Percentage of Met residues: 4.32 %
Number of Cys residues: 1
Percentage of Cys residues: 0.72 %
SEQUENCE  amino acids 139 aa
>TM1506  TM1506 conserved hypothetical protein
MEKNLLRSALKIFEKKDLSLLAYSGRSIFESKDSGLKPVVELFKRFDNLEGSLVIDKMVG
KAAASFLLKMKPDHIHAKVISKPALKLMNEYGQSFSYDEKIPFVLGKDGKSMCPFEKLVL
EMDDPEEIIRIVLSKFTSL

CDS  cDNA 417 bp
   1 gtggagaaaa accttttaag atcagctttg aaaatcttcg agaagaaaga tctaagtttg    60
  61 ctggcttata gcggccgatc gatcttcgaa agtaaagaca gcggcctcaa acccgtggtg   120
 121 gagcttttca aaaggttcga taatctggaa ggaagcctgg tgatcgacaa aatggttgga   180
 181 aaggctgcgg cttcttttct gttgaaaatg aaacccgatc acatccacgc aaaagttata   240
 241 agcaagccgg cgttgaaatt gatgaatgaa tacggacagt ctttcagtta tgatgaaaaa   300
 301 atacctttcg tcctgggaaa agatggcaag agtatgtgtc cattcgaaaa actggttctg   360
 361 gagatggacg acccggagga aatcataagg attgttcttt caaaattcac gtcactt   417
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1503133 1503552 -1 Glimmer3 score 8.1 poor
Genemark probabilities .7   .51 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu