LOADING...
   TM1492;TM1492
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1492    TM1492            JCSG 283349 PDB Deposition 03-OCT-17              PDB id: 1r73

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1492
DESCRIPTION50S ribosomal protein L29.
ORGANISMThermotoga maritima
COMMENTGenome and functional context: on a chromosome this gene is surrounded by the huge conservative cluster (in more than 40 organisms) of genes TM1471 -TM1505` ( Adenylate kinase (EC 2.7.4.3), DNA-directed RNA polymerase alpha chain (EC 2.7.7.6), translation initiation factor and various ribosomal proteins.
--------------------------------------------------------------------------------
-!- SIMILARITY: BELONGS TO THE L29P FAMILY OF RIBOSOMAL PROTEINS.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; RL29_THEMA
DR SPTR; P38514 (flat text); P38514 (good view)
DR GenBank; CAA79785
DR Pfam; PF00831; Ribosomal_L29;
DR Interpro; IPR001854; Ribosomal_L29;
DR PDB; 1R73; Identical; 10-AUG-04; 50S RIBOSOMAL PROTEIN L29;
DR PDB; 3J3V; Highly similar; 12-JUN-13; 50S RIBOSOMAL PROTEIN L32;
DR PDB; 3J3W; Highly similar; 12-JUN-13; RIBOSOME RNA 23S;
DR PDB; 4WCE; Highly similar; 21-OCT-15; 23S RRNA;
DR PDB; 4WF9; Highly similar; 21-OCT-15; STAPHYLOCOCCUS AUREUS SUBSP. AUREUS NCTC 8325, CO GENOME;
DR PDB; 4WFA; Highly similar; 21-OCT-15; 23S RRNA;
DR PDB; 4WFB; Highly similar; 21-OCT-15; 23S RRNA;
DR PDB; 2J01; Highly similar; 28-SEP-06; 23S RIBOSOMAL RNA;
DR FFAS; 283349; Fold and function assignment.
DR TVPC; TM1492; Homologs in PDB, JCSG and SG center.
DR OVP; TM1492; Ortholog view popup.
DR TPM; TM1492; Target PDB monitor.
DR FSS; TM1492; Target function coverage.
PROPERTY Residues: 66 aa
Molecule Weight: 7972.04 Dalton
Isoelectric Point: 10.27
Extinction Coefficient: 1490
Gravy Index: -.83
Number of Met residues: 3
Percentage of Met residues: 4.55 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 66 aa
>TM1492  TM1492 ribosomal protein L29 (rpmC)
MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRER
ELGIRR

CDS  cDNA 198 bp
   1 atgaaggctt ccgaactcag gaactacaca gatgaagaat tgaagaacct tctcgaagaa    60
  61 aagaagaggc agctcatgga actcagattc caacttgcga tgggacagct gaagaatact   120
 121 tctctcataa agctcactaa gagagatatt gccaggataa agaccattct cagagagagg   180
 181 gagttaggca taaggagg   198
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1493924 1494124 -2 Glimmer3 score 14.39 good
Genemark probabilities .59   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu