LOADING...
   TM1478;TM1478
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1478    TM1478            JCSG 283335 PDB Deposition 02-SEP-13              PDB id: 1o0x

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1478
DESCRIPTIONMethionine aminopeptidase (EC 3.4.11.18) (MAP) (Peptidase M).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: REMOVES THE AMINO-TERMINAL METHIONINE FROM NASCENT
PROTEINS.
-!- CATALYTIC ACTIVITY: L-METHIONYLPEPTIDE + H(2)O = L-METHIONINE +
PEPTIDE.
-!- COFACTOR: COBALT (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO PEPTIDASE FAMILY M24A; ALSO KNOWN AS THE
MAP FAMILY 1.
DR UNIPROT; Q9X1I7_THEMA
DR SPTR; Q9X1I7 (flat text); Q9X1I7 (good view)
DR GenBank; AAD36544
DR Pfam; PF00557; Peptidase_M24;
DR Interpro; IPR002467; Pept_M24A_MAP1;
DR Interpro; IPR001714; Pept_M24_MAP;
DR Interpro; IPR000994; Peptidase_M24;
DR PDB; 1O0X; Identical; 06-NOV-02; METHIONINE AMINOPEPTIDASE;
DR PDB; 3TB5; Highly similar; 08-AUG-12; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG0; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG2; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG3; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG5; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG7; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR PDB; 2GG8; Highly similar; 13-JUN-06; METHIONINE AMINOPEPTIDASE;
DR KEGG; 3.4.11.18; Enzyme page
DR FFAS; 283335; Fold and function assignment.
DR TVPC; TM1478; Homologs in PDB, JCSG and SG center.
DR OVP; TM1478; Ortholog view popup.
DR TPM; TM1478; Target PDB monitor.
DR FSS; TM1478; Target function coverage.
PROPERTY Residues: 250 aa
Molecule Weight: 27487.5 Dalton
Isoelectric Point: 6.62
Extinction Coefficient: 28420
Gravy Index: -.11
Number of Met residues: 5
Percentage of Met residues: 2.00 %
Number of Cys residues: 3
Percentage of Cys residues: 1.20 %
SEQUENCE  amino acids 250 aa
>TM1478  TM1478 methionine aminopeptidase (map)
MIRIKTPSEIEKMKKAGKAVAVALREVRKVIVPGKTAWDVETLVLEIFKKLRVKPAFKGY
GGYKYATCVSVNEEVVHGLPLKEKVFKEGDIVSVDVGAVYQGLYGDAAVTYIVGETDERG
KELVRVTREVLEKAIKMIKPGIRLGDVSHCIQETVESVGFNVIRDYVGHGVGRELHEDPQ
IPNYGTPGTGVVLRKGMTLAIEPMVSEGDWRVVVKEDGWTAVTVDGSRCAHFEHTILITE
NGAEILTKEG

CDS  cDNA 750 bp
   1 atgataagaa taaagacacc ctctgagatc gagaaaatga aaaaagccgg aaaagcggtc    60
  61 gcagtagctt tgagggaagt tagaaaggtg atcgttccag gaaaaaccgc atgggatgtt   120
 121 gaaacacttg ttctggagat cttcaaaaaa ctcagagtca aaccagcttt caagggatac   180
 181 ggtggttaca aatacgcaac ttgtgtttct gtgaacgaag aggtggtaca cggtcttcct   240
 241 ttgaaggaga aggtttttaa agaaggagac attgtatctg tagatgtcgg agcggtatat   300
 301 cagggacttt acggtgatgc ggccgttaca tacatcgttg gagaaaccga tgaaagagga   360
 361 aaagaactgg tgagagtaac aagagaggtt ctggaaaagg ctataaagat gataaaaccc   420
 421 ggcatcagac ttggagatgt ttcgcactgt attcaagaaa cagttgaatc ggtaggtttc   480
 481 aacgtgatca gggattatgt gggtcatgga gtggggagag aactccacga agaccctcaa   540
 541 attccaaact acggaacacc cggaacgggt gtggtattaa gaaagggtat gacgctggcc   600
 601 atagaaccca tggtgagtga aggagactgg agagttgttg tgaaagaaga cggatggaca   660
 661 gccgttacag tagacggttc cagatgcgct cattttgaac acacgattct gataacagaa   720
 721 aacggggcgg agatattgac caaggaggga   750
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1486871 1487623 -2 Glimmer3 score 13.7 good
Genemark probabilities .86   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu