LOADING...
   TM1468;TM1468
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1468    TM1468            JCSG 283326 PDB Deposition 04-NOV-18              PDB id: 1vpv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1468
DESCRIPTIONPutative lipid binding protein, from the DegV family [DAK1/DegV-like]
ORGANISMThermotoga maritima
COMMENT-!- SIMILARITY: BELONGS TO THE UPF0230 (DEGV) FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y1468_THEMA
DR SPTR; Q9X1H9 (flat text); Q9X1H9 (good view)
DR GenBank; AAD36536
DR Pfam; PF02645; DegV;
DR Interpro; IPR003797; DegV;
DR PDB; 1MGP; Identical; 18-SEP-02; HYPOTHETICAL PROTEIN TM841;
DR PDB; 1VPV; Identical; 07-DEC-04; UPF0230 PROTEIN TM1468;
DR PDB; 3FYS; Highly similar; 12-MAY-09; PROTEIN DEGV;
DR PDB; 2DT8; Highly similar; 19-JUN-07; DEGV FAMILY PROTEIN;
DR PDB; 1PZX; Highly similar; 20-JAN-04; HYPOTHETICAL PROTEIN APC36103;
DR PDB; 3PL5; Highly similar; 07-DEC-11; PUTATIVE UNCHARACTERIZED PROTEIN;
DR FFAS; 283326; Fold and function assignment.
DR TVPC; TM1468; Homologs in PDB, JCSG and SG center.
DR OVP; TM1468; Ortholog view popup.
DR TPM; TM1468; Target PDB monitor.
DR FSS; TM1468; Target function coverage.
PROPERTY Residues: 288 aa
Molecule Weight: 32572.9 Dalton
Isoelectric Point: 5.86
Extinction Coefficient: 28880
Gravy Index: -.27
Number of Met residues: 6
Percentage of Met residues: 2.08 %
Number of Cys residues: 1
Percentage of Cys residues: 0.35 %
SEQUENCE  amino acids 288 aa
>TM1468  TM1468 conserved hypothetical protein
MKVKILVDSTADVPFSWMEKYDIDSIPLYVVWEDGRSEPDEREPEEIMNFYKRIREAGSV
PKTSQPSVEDFKKRYLKYKEEDYDVVLVLTLSSKLSGTYNSAVLASKEVDIPVYVVDTLL
ASGAIPLPARVAREMLENGATIEEVLKKLDERMKNKDFKAIFYVSNFDYLVKGGRVSKFQ
GFVGNLLKIRVCLHIENGELIPYRKVRGDKKAIEALIEKLREDTPEGSKLRVIGVHADNE
AGVVELLNTLRKSYEVVDEIISPMGKVITTHVGPGTVGFGIEVLERKR

CDS  cDNA 864 bp
   1 atgaaggtaa agattctcgt tgacagcacg gccgatgttc ctttttcctg gatggaaaaa    60
  61 tacgatatag atagcatccc actttacgtg gtgtgggaag acggaagatc cgagccggac   120
 121 gaaagagaac cggaagagat aatgaacttt tacaagagaa taagagaagc aggcagtgta   180
 181 ccaaagactt cccagccgag tgtggaggat ttcaagaaga gatatctgaa gtacaaagaa   240
 241 gaggattacg atgttgtcct ggttctcact ttatcatcga aactctccgg aacttacaat   300
 301 tccgctgttc tcgcatccaa agaggtggac atacccgttt acgttgtgga tactcttctc   360
 361 gcttcgggtg cgatacccct tccggcccgt gtggctcgtg aaatgctcga aaatggtgcc   420
 421 accatcgagg aagtactgaa aaaactcgat gagagaatga agaacaagga cttcaaagcg   480
 481 attttttatg tttcgaattt cgattatctt gttaaggggg gaagggtgtc gaagttccag   540
 541 ggatttgtgg gaaatcttct caagataaga gtgtgtcttc acatagagaa cggtgagctc   600
 601 atcccttaca gaaaggtcag aggagacaag aaggcgatag aagccctcat agaaaaactg   660
 661 cgtgaggata ctcctgaagg ctcgaagctg agagtgatag gtgttcacgc ggacaacgag   720
 721 gctggagtcg tggagctttt gaacacactc agaaaaagtt acgaggttgt cgacgagatc   780
 781 atatcgccga tgggaaaggt gatcacgact catgtgggac ccgggacggt tgggtttgga   840
 841 atcgaggttt tagaacgaaa aaga   864
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1480478 1481344 -2 Glimmer3 score 14.44 good
Genemark probabilities .89   .85 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu