LOADING...
   TM1464;TM1464
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1464    TM1464            JCSG 283322 PDB Deposition 04-JUN-09              PDB id: 1vkm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1464
DESCRIPTIONindigoidine synthase A (IdgA)-like protein, possibly involved in carbohydrate metabolism [Indigoidine synthase A-like]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1H5_THEMA
DR SPTR; Q9X1H5 (flat text); Q9X1H5 (good view)
DR GenBank; AAD36532
DR Pfam; PF04227; Indigoidine_A;
DR Interpro; IPR007342; Indigdn_synthA;
DR PDB; 1VKM; Identical; 29-JUN-04; CONSERVED HYPOTHETICAL PROTEIN TM1464;
DR PDB; 4GIJ; Highly similar; 31-OCT-12; PSEUDOURIDINE-5'-PHOSPHATE GLYCOSIDASE;
DR PDB; 4GIK; Highly similar; 31-OCT-12; PSEUDOURIDINE-5'-PHOSPHATE GLYCOSIDASE;
DR PDB; 4GIL; Highly similar; 31-OCT-12; PSEUDOURIDINE-5'-PHOSPHATE GLYCOSIDASE;
DR PDB; 4GIM; Highly similar; 31-OCT-12; PSEUDOURIDINE-5'-PHOSPHATE GLYCOSIDASE;
DR PDB; 4EX8; Highly similar; 16-JAN-13; ALNA;
DR PDB; 4EX9; Highly similar; 16-JAN-13; ALNA;
DR FFAS; 283322; Fold and function assignment.
DR TVPC; TM1464; Homologs in PDB, JCSG and SG center.
DR OVP; TM1464; Ortholog view popup.
DR TPM; TM1464; Target PDB monitor.
DR FSS; TM1464; Target function coverage.
PROPERTY Residues: 285 aa
Molecule Weight: 31726.41 Dalton
Isoelectric Point: 5.48
Extinction Coefficient: 2980
Gravy Index: -.07
Number of Met residues: 11
Percentage of Met residues: 3.86 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 285 aa
>TM1464  TM1464 conserved hypothetical protein
MIIESRIEKGKPVVGMETTVFVHGLPRKEAIELFRRAKEISREKGFQLAVIGILKGKIVA
GMSEEELEAMMREGADKVGTREIPIVVAEGKNAATTVSATIFLSRRIGIEVVVTGGTGGV
HPGRVDVSQDLTEMSSSRAVLVSSGIKSILDVEATFEMLETLEIPLVGFRTNEFPLFFSR
KSGRRVPRIENVEEVLKIYESMKEMELEKTLMVLNPVPEEYEIPHDEIERLLEKIELEVE
GKEVTPFLLKKLVEMTNGRTLKANLALLEENVKLAGEIAVKLKRS

CDS  cDNA 855 bp
   1 gtgatcatag aaagcaggat agaaaaagga aagcccgttg tagggatgga aaccacagtg    60
  61 tttgttcatg gactgcccag aaaggaagcc atagagttgt tcagaagggc gaaagagata   120
 121 tccagagaaa aagggttcca gcttgcggtt ataggcatcc tgaagggaaa gatcgtcgct   180
 181 ggcatgagtg aagaagaact cgaggcgatg atgagagaag gtgccgataa ggtaggtacg   240
 241 cgagaaattc ccattgtggt ggctgaggga aaaaacgctg cgactactgt gagtgccacc   300
 301 atctttctct ccagacgaat cggaatagag gtcgttgtaa ccggaggaac tgggggtgtt   360
 361 catcccggac gtgtggacgt ttctcaggat ctcaccgaga tgtcttcttc gcgcgcagtt   420
 421 ctcgtatcca gcgggataaa gtccattctt gatgtggaag caactttcga gatgcttgaa   480
 481 actttagaga ttcctctggt tggtttcaga acgaacgagt tcccgttgtt tttctcgagg   540
 541 aaaagcggcc gaagggttcc aaggatagaa aatgtagagg aagtcttgaa aatctacgaa   600
 601 tccatgaaag aaatggaact tgagaaaacc ctcatggtgc tgaatcctgt gccggaggag   660
 661 tacgaaatac cgcacgatga aatagaacgt cttcttgaaa agatcgagct ggaggttgaa   720
 721 ggaaaagaag tgactccttt tcttctcaaa aagctcgtgg agatgacgaa tggaagaact   780
 781 ctgaaggcga atcttgctct tctcgaagaa aacgtgaaac tcgcgggaga gattgcggta   840
 841 aaactcaaac gctcg   855
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1476447 1477304 -3 Glimmer3 score 15.07 good
Genemark probabilities .89   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu