LOADING...
   TM1459;TM1459
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1459    TM1459            JCSG 283317 PDB Deposition 03-DEC-03              PDB id: 1vj2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1459
DESCRIPTIONNovel family of manganese-containing cupin
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1H0_THEMA
DR SPTR; Q9X1H0 (flat text); Q9X1H0 (good view)
DR GenBank; AAD36527
DR Pfam; PF07883; Cupin_2;
DR Interpro; IPR007113; Cupin_sup;
DR PDB; 1VJ2; Identical; 09-DEC-03; NOVEL MANGANESE-CONTAINING CUPIN TM1459;
DR PDB; 3HT1; Highly similar; 13-OCT-09; REMF PROTEIN;
DR PDB; 3HT2; Highly similar; 13-OCT-09; REMF PROTEIN;
DR FFAS; 283317; Fold and function assignment.
DR TVPC; TM1459; Homologs in PDB, JCSG and SG center.
DR OVP; TM1459; Ortholog view popup.
DR TPM; TM1459; Target PDB monitor.
DR FSS; TM1459; Target function coverage.
PROPERTY Residues: 114 aa
Molecule Weight: 13108.44 Dalton
Isoelectric Point: 5.6
Extinction Coefficient: 8480
Gravy Index: -.38
Number of Met residues: 2
Percentage of Met residues: 1.75 %
Number of Cys residues: 1
Percentage of Cys residues: 0.88 %
SEQUENCE  amino acids 114 aa
>TM1459  TM1459 conserved hypothetical protein
MILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRHSHPWEHEI
FVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCLIPKEGGE

CDS  cDNA 342 bp
   1 atgatattaa agagagcata tgatgtcact ccccagaaaa tttcaaccga taaggtacga    60
  61 ggagttcgta aaagagtcct cataggcttg aaagatgctc cgaactttgt catgagactt   120
 121 ttcacggtgg aacctggcgg tctcatcgac agacactccc atccatggga gcacgagatt   180
 181 ttcgttttga agggaaagct cacagttttg aaggagcaag gcgaggagac ggtagaagaa   240
 241 ggtttttaca tcttcgtgga acccaatgaa atacacggct tcaggaacga tacagactcc   300
 301 gaagtggagt ttctctgttt gatacctaag gaaggcggag ag   342
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1473341 1473685 -2 Glimmer3 score 6.2 poor
Genemark probabilities .66   .02 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu