LOADING...
   TM1442;TM1442
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1442    TM1442            JCSG 283301 PDB Deposition 04-MAY-07              PDB id: 1sbo, 1t6r

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1442
DESCRIPTIONPutative anti sigma factor antagonist in its phosphorylated state [SpoIIaa-like]
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: IN THE PHOSPHORYLATED FORM IT COULD ACT AS AN ANTI-ANTI-
SIGMA FACTOR THAT COUNTERACTS AN ANTI-SIGMA FACTOR AND THUS
RELEASE A SIGMA FACTOR FROM INHIBITION (BY SIMILARITY).
-!- PTM: PHOSPHORYLATED ON A SERINE RESIDUE (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE ANTI-SIGMA-FACTOR ANTAGONIST FAMILY.
-!- SIMILARITY: CONTAINS 1 STAS DOMAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y1442_THEMA
DR SPTR; Q9X1F5 (flat text); Q9X1F5 (good view)
DR GenBank; AAD36511
DR Pfam; PF01740; STAS;
DR Interpro; IPR003658; Antisig_antgnst;
DR Interpro; IPR002645; STAS;
DR PDB; 1VC1; Identical; 28-SEP-04; PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM1442;
DR PDB; 1SBO; Identical; 21-DEC-04; PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM1442;
DR PDB; 1T6R; Identical; 24-MAY-05; PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM1442;
DR PDB; 2KA5; Highly similar; 25-NOV-08; PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM_1081;
DR PDB; 3F43; Highly similar; 25-NOV-08; PUTATIVE ANTI-SIGMA FACTOR ANTAGONIST TM1081;
DR FFAS; 283301; Fold and function assignment.
DR TVPC; TM1442; Homologs in PDB, JCSG and SG center.
DR OVP; TM1442; Ortholog view popup.
DR TPM; TM1442; Target PDB monitor.
DR FSS; TM1442; Target function coverage.
PROPERTY Residues: 110 aa
Molecule Weight: 12299.53 Dalton
Isoelectric Point: 5.81
Extinction Coefficient: 2980
Gravy Index: -.12
Number of Met residues: 2
Percentage of Met residues: 1.82 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 110 aa
>TM1442  TM1442 anti-sigma factor antagonist, putative
MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSA
GLGTLVVILKDAKINGKEFILSSLKESISRILKLTHLDKIFKITDTVEEA

CDS  cDNA 330 bp
   1 atgaacaacc tcaaactcga tatcgttgaa caggatgaca aagccatcgt gagagtgcag    60
  61 ggggacatag acgcttacaa ttcttcggag ttgaaggaac agcttagaaa cttcatctcg   120
 121 accaccagca agaagaagat cgtcctcgat ctttcgtctg tctcctacat ggacagcgcg   180
 181 ggccttggaa cactcgttgt gattttgaag gacgcgaaaa tcaacggaaa ggagttcatc   240
 241 ctcagctcac tgaaagaaag catatcgaga atactaaaac ttacccatct cgataagatc   300
 301 ttcaaaatca ccgatacagt ggaggaggcg   330
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1457901 1458233 3 Glimmer3 score 11.72 poor
Genemark probabilities .77   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu