LOADING...
   TM1438;TM1438
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1438    TM1438            JCSG 358531 MR Tracing 05-MAR-08

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1438
DESCRIPTIONTM1438
ORGANISMTHERMOTOGA MARITIMA
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF09210; DUF1957;
DR Pfam; PF03065; Glyco_hydro_57;
DR PDB; 2B5D; Identical; 07-MAR-06; ALPHA-AMYLASE;
DR PDB; 3N8T; Highly similar; 27-OCT-10; ALPHA-AMYLASE, GH57 FAMILY;
DR PDB; 3N92; Highly similar; 27-OCT-10; ALPHA-AMYLASE, GH57 FAMILY;
DR PDB; 3N98; Highly similar; 27-OCT-10; ALPHA-AMYLASE, GH57 FAMILY;
DR PDB; 3P0B; Highly similar; 20-OCT-10; TT1467 PROTEIN;
DR PDB; 1UFA; Highly similar; 28-NOV-03; TT1467 PROTEIN;
DR FFAS; 358531; Fold and function assignment.
DR TVPC; TM1438; Homologs in PDB, JCSG and SG center.
DR OVP; TM1438; Ortholog view popup.
DR TPM; TM1438; Target PDB monitor.
DR FSS; TM1438; Target function coverage.
PROPERTY Residues: 528 aa
Molecule Weight: 62756.46 Dalton
Isoelectric Point: 5.42
Extinction Coefficient: 109670
Gravy Index: -.4
Number of Met residues: 21
Percentage of Met residues: 3.98 %
Number of Cys residues: 2
Percentage of Cys residues: 0.38 %
SEQUENCE  amino acids 528 aa
>TM1438  TM1438
MRGKILIFLHAHLPYVHHPEYDHFLEERWLFEAITETYIPLLMMFDEIEDFRLTMSITPP
LMEMLSSRDLQEKYERHMEKLIELANKEVERTKKEHPLKHKMAKFYREHFEKILNVFRSY
DGNILEGFKKYQETGKLEIVTCNATHAFLPLYQMYPEVVNAQITVGVKNYAKHMTLHPRG
IWLAECGYYQGLDLYLAQNNVEYFFVDSHAFWFADEQPRYGVYRPIMTPSGVFAFARDPE
SSEQVWSAAVGYPGDPRYREFYRDIGFDREMEYIKDYIDPSGVRINTGIKYHRITSKSLD
ASQKEYYDIDLAMEAVEEHARDFLHKKESQARRLMDIMGVEPVIVAPFDAELFGHWWFEG
VFFLKRFFELVNESKDLKLVTASEVIDTLEEVQIATPADSSWGAGGYYETWLNGTNDWIY
RHLHEMIERMIDLSKKYYNSSDPLVERVLNQMLRELFLAQSSDWAFIMTTRTSVQYAENR
TKLHIKRFLNLYDQLVSGRIDEEMLRYYEWTDAIFPEINFRVMARDVI

CDS  cDNA 1584 bp
   1 atgagaggaa aaatactgat atttctgcat gcgcatcttc catacgttca ccatcctgaa    60
  61 tacgatcatt ttttggaaga aaggtggctt tttgaggcca taacagaaac ttacataccg   120
 121 cttttaatga tgttcgatga aatagaagat ttcaggttga ccatgtcgat cactcctccg   180
 181 ctgatggaga tgctctcctc cagagacctt caggagaagt acgaaagaca catggaaaaa   240
 241 ctgatcgaac tcgcaaacaa ggaagtggag agaactaaaa aggagcaccc gctgaagcat   300
 301 aagatggcta aattctaccg tgaacatttt gaaaaaattc tgaacgtgtt tcgctcttac   360
 361 gatggaaaca tcttggaggg cttcaaaaaa taccaggaga ccggaaagct ggagatagtg   420
 421 acctgcaacg ccacacacgc gtttttgccg ctctatcaga tgtacccaga ggtggtgaac   480
 481 gctcagatca cagttggcgt gaagaactac gctaagcaca tgacgtaaca cccaaggggt   540
 541 atttggcttg cggaatgcgg atactatcag gggctggatc tgtaccttgc ccagaacaac   600
 601 gttgagtatt tctttgtgga ttctcatgcc ttctggttcg ccgatgaaca acccagatac   660
 661 ggtgtctaca gacccatcat gacgccaagt ggtgttttcg ccttcgcacg agatccggag   720
 721 tcgagcgaac aggtctggag tgcagccgtt gggtatcctg gtgatccaag gtacagagaa   780
 781 ttctacagag atataggttt cgacagagaa atggagtaca taaaagatta catagaccct   840
 841 tctggagtca ggataaacac cggaataaaa taccacagga taacttcgaa aagcttggat   900
 901 gcttcgcaga aagaatatta cgacatagat ctggccatgg aagctgtgga agaacacgcg   960
 961 agggacttcc ttcacaaaaa ggaaagtcag gcaagaagat tgatggatat aatgggtgtc  1020
1021 gaaccggtca tcgttgctcc cttcgacgct gagctcttcg gtcactggtg gttcgagggt  1080
1081 gtgttcttct tgaagaggtt ctttgaactg gtgaatgaat caaaagacct gaagctcgtc  1140
1141 accgcatccg aagttataga cactctcgaa gaggttcaga tcgccacacc cgccgactcg  1200
1201 agctggggtg ccggaggata ctacgaaacg tggctcaacg gaacgaacga ctggatctac  1260
1261 aggcatctcc acgagatgat cgaaagaatg atagatcttt cgaaaaagta ctacaacagt  1320
1321 tccgatccac tcgtggaaag ggttttgaat cagatgctga gagaactatt tctcgcacaa  1380
1381 tcgagcgact gggctttcat catgactaca agaacgagtg ttcaatacgc ggaaaacaga  1440
1441 acgaagcttc acataaagag gtttctgaac ctctacgatc aactcgtttc tggaagaata  1500
1501 gacgaagaga tgctaagata ctacgagtgg acggatgcca tctttccaga gataaacttc  1560
1561 agggtgatgg cgagggatgt gatt  1584
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu