LOADING...
   TM1436;TM1436
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1436    TM1436            JCSG 283296 PDB Deposition 04-MAY-13              PDB id: 1vkf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1436
DESCRIPTIONGlycerol uptake operon antiterminator-related protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1F0_THEMA
DR SPTR; Q9X1F0 (flat text); Q9X1F0 (good view)
DR GenBank; AAD36506
DR Pfam; PF04309; G3P_antiterm;
DR Interpro; IPR006699; G3P_antiterm;
DR PDB; 1VKF; Identical; 25-MAY-04; GLYCEROL UPTAKE OPERON ANTITERMINATOR-RELATED PRO CHAIN: A,;
DR PDB; 3KTS; Highly similar; 08-DEC-09; GLYCEROL UPTAKE OPERON ANTITERMINATOR REGULATORY CHAIN: A, B;
DR FFAS; 283296; Fold and function assignment.
DR TVPC; TM1436; Homologs in PDB, JCSG and SG center.
DR OVP; TM1436; Ortholog view popup.
DR TPM; TM1436; Target PDB monitor.
DR FSS; TM1436; Target function coverage.
PROPERTY Residues: 176 aa
Molecule Weight: 19295.77 Dalton
Isoelectric Point: 7.89
Extinction Coefficient: 12490
Gravy Index: .26
Number of Met residues: 4
Percentage of Met residues: 2.27 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 176 aa
>TM1436  TM1436 glycerol uptake operon antiterminator-related protein
MFKGIIAALWDMDSIGEIEPDVVFLLKSDILNLKFHLKILKDRGKTVFVDMDFVNGLGEG
EEAILFVKKAGADGIITIKPKNYVVAKKNGIPAVLRFFALDSKAVERGIEQIETLGVDVV
EVLPGAVAPKVARKIPGRTVIAAGLVETEEEAREILKHVSAISTSSRILWKMKFLP

CDS  cDNA 528 bp
   1 atgttcaagg ggataatagc tgcgctgtgg gatatggatt ccataggaga aatagaaccc    60
  61 gatgtggtct tccttttgaa gagcgacatt ttgaatctga agtttcatct gaagattctc   120
 121 aaagacaggg gaaaaaccgt ttttgttgat atggattttg tgaacggact aggagaggga   180
 181 gaagaagcga ttctttttgt gaaaaaggcc ggtgccgatg gtatcatcac gataaagcca   240
 241 aaaaattacg tcgttgcaaa gaagaacgga attcccgctg tcctcagatt ctttgctctc   300
 301 gactcgaaag cggtcgaaag aggtatcgaa cagatagaaa cgctcggggt agatgtggtg   360
 361 gaagtccttc caggtgcggt ggctccgaaa gtggccagaa aaatacccgg caggacagtg   420
 421 atcgccgccg ggctcgttga aacagaggaa gaagctcgcg aaatcctcaa acacgtttca   480
 481 gcgatctcta caagttcaag aatcctctgg aagatgaagt ttctacca   528
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1451621 1452151 -2 Glimmer3 score 14.15 good
Genemark probabilities .84   .7 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu