LOADING...
   TM1419;TM1419
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1419    TM1419            JCSG 283279 PDB Deposition 08-MAR-11              PDB id: 3cin

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1419
DESCRIPTIONMyo-inositol-1-phosphate synthase-related protein
ORGANISMThermotoga maritima
COMMENT By similarity: Multiple external annotations of close homologs from various sources consistently point to function:
Myo-inositol-1-phosphate synthase (EC 5.5.1.4).
Strongly supportive genome and functional context:
TM1419 forms on a chromosome a conserved cluster with TM1415 - Inositol-1-monophosphatase (EC 3.1.3.25) the key enzyme of Inositol phosphate metabolism ( KEGG MAP00562 ).
DR UNIPROT; Q9X1D6_THEMA
DR SPTR; Q9X1D6 (flat text); Q9X1D6 (good view)
DR GenBank; AAD36489
DR Pfam; PF07994; NAD_binding_5;
DR Pfam; PF01658; Inos-1-P_synth;
DR Interpro; IPR002587; Inos-1-P_synth;
DR PDB; 3CIN; Identical; 25-MAR-08; MYO-INOSITOL-1-PHOSPHATE SYNTHASE-RELATED PROTEIN CHAIN: A;
DR KEGG; 5.5.1.4; Enzyme page
DR FFAS; 283279; Fold and function assignment.
DR TVPC; TM1419; Homologs in PDB, JCSG and SG center.
DR OVP; TM1419; Ortholog view popup.
DR TPM; TM1419; Target PDB monitor.
DR FSS; TM1419; Target function coverage.
PROPERTY Residues: 382 aa
Molecule Weight: 42192.09 Dalton
Isoelectric Point: 5.31
Extinction Coefficient: 44350
Gravy Index: -.17
Number of Met residues: 6
Percentage of Met residues: 1.57 %
Number of Cys residues: 1
Percentage of Cys residues: 0.26 %
SEQUENCE  amino acids 382 aa
>TM1419  TM1419 myo-inositol-1-phosphate synthase-related protein
MVKVLILGQGYVASTFVAGLEKLRKGEIEPYGVPLARELPIGFEDIKIVGSYDVDRAKIG
KKLSEVVKQYWNDVDSLTSDPEIRKGVHLGSVRNLPIEAEGLEDSMTLKEAVDTLVKEWT
ELDPDVIVNTCTTEAFVPFGNKEDLLKAIENNDKERLTATQVYAYAAALYANKRGGAAFV
NVIPTFIANDPAFVELAKENNLVVFGDDGATGATPFTADVLSHLAQRNRYVKDVAQFNIG
GNMDFLALTDDGKNKSKEFTKSSIVKDILGYDAPHYIKPTGYLEPLGDKKFIAIHIEYVS
FNGATDELMINGRINDSPALGGLLVDLVRLGKIALDRKEFGTVYPVNAFYMKNPGPAEEK
NIPRIIAYEKMRIWAGLKPKWL

CDS  cDNA 1146 bp
   1 atggtcaagg tcctgatcct cggtcagggc tacgttgcca gtacattcgt tgccggactt    60
  61 gaaaagctca ggaaagggga aatagaacct tacggagtgc cccttgcaag ggaacttccc   120
 121 atcggcttcg aagacatcaa gattgttgga agctacgacg tggacagagc gaagattgga   180
 181 aagaaactga gcgaagtggt gaagcagtac tggaacgatg ttgactcgct gacgagtgat   240
 241 cctgagattc gcaaaggagt acaccttgga agcgtgagga acctccccat cgaagctgaa   300
 301 ggtctcgaag acagcatgac tctgaaggaa gcagttgata ctctcgtcaa ggaatggaca   360
 361 gaactcgatc ccgatgtgat cgtgaacacc tgtactacag aagctttcgt gcccttcggg   420
 421 aacaaagaag atcttctgaa agctatcgaa aacaacgaca aagagagact cactgcaact   480
 481 caggtgtacg cttacgcagc ggcactgtac gcgaacaagc gtggaggagc ggcttttgtg   540
 541 aacgttattc cgaccttcat agcgaacgac ccggctttcg ttgaactcgc gaaggagaac   600
 601 aacctcgtcg ttttcggaga cgacggtgct accggtgcca caccgttcac agcggacgtt   660
 661 ctcagccatc ttgcccagag aaacaggtac gtcaaagatg ttgcgcagtt caacatagga   720
 721 gggaacatgg actttctggc actcacagac gatggaaaga acaagagtaa agaattcacc   780
 781 aaatccagta tagtgaagga cattctcggt tacgatgcac cgcattacat aaaacctaca   840
 841 gggtatcttg aaccacttgg agataaaaag ttcatagcca ttcacatcga gtacgtgagt   900
 901 ttcaacggtg ctacagatga gctcatgata aacggaagaa taaacgacag cccggctctt   960
 961 ggaggtctcc ttgttgacct tgtgagactc ggaaagatcg cactcgacag gaaggagttc  1020
1021 ggaacggtct acccagtgaa cgccttctac atgaagaacc cgggaccggc ggaagaaaag  1080
1081 aacatcccaa gaatcattgc ttacgagaag atgagaatct gggcgggatt gaaaccgaag  1140
1141 tggctg  1146
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1434136 1435284 -1 Glimmer3 score 12.08 good
Genemark probabilities .95   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu