LOADING...
   TM1410;TM1410
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1410    TM1410            JCSG 358470 PDB Deposition 05-JUL-13              PDB id: 2aam

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1410
DESCRIPTIONPutative glycosidase with a TIM-barrel fold.
ORGANISMThermotoga maritima
COMMENTPlease see topsan for an ongoing discussion. This is a very controversal
protein structure. (chrisx)
--------------------------------------------------------------------------
-!- SIMILARITY: TO M.JANNASCHII MJ1477 AND T.MARITIMA TM1410.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; Y1410_THEMA
DR SPTR; Q9RWG3 (flat text); Q9RWG3 (good view)
DR GenBank; AAF10284
DR Pfam; PF03537; Glyco_hydro_114;
DR Interpro; IPR004352; TM1410_related;
DR PDB; 2AAM; Identical; 26-JUL-05; HYPOTHETICAL PROTEIN TM1410;
DR KEGG; 3.; Enzyme page
DR FFAS; 283271; Fold and function assignment.
DR TVPC; TM1410; Homologs in PDB, JCSG and SG center.
DR OVP; TM1410; Ortholog view popup.
DR TPM; TM1410; Target PDB monitor.
DR FSS; TM1410; Target function coverage.
PROPERTY Residues: 323 aa
Molecule Weight: 37717.45 Dalton
Isoelectric Point: 4.47
Extinction Coefficient: 87780
Gravy Index: -.36
Number of Met residues: 7
Percentage of Met residues: 2.17 %
Number of Cys residues: 2
Percentage of Cys residues: 0.62 %
SEQUENCE  amino acids 323 aa
>TM1410  TM1410 conserved hypothetical protein
MSHLKNILFIIIVSLFFISSCSTVMSTEGWFMPFDNWLYQLQNADPVEISSSGFEIAVID
YSKDGSESGEYSPEEIKIMVDAGVVPVAYVNIGQAEDYRFYWKESWYTNTPEWLGEEDPA
WPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARKMI
NFVLEIAEYVRERKPDMLIIPQNGENILDFDDGQLASTVSGWAVENLFYLKTIPLEENET
KSRLEYLIRLNRKGKFILSVDYVDDGSDSFENISRILDYYEKAKRNGCIPYAARSDLELD
EMNVIEGIQPPEALKDYESRTYR

CDS  cDNA 969 bp
   1 atgtctcacc tcaaaaacat tctgttcatt attatagtat cattgttttt catttcctcc    60
  61 tgctcaacgg ttatgtcaac agagggatgg ttcatgcctt ttgacaattg gctttatcaa   120
 121 ctccagaacg ctgatcccgt ggagatatct tcatccggct ttgaaattgc cgttatagat   180
 181 tactcaaaag acggaagtga aagtggagaa tattcacctg aagagattaa aatcatggta   240
 241 gatgcgggag ttgttcctgt tgcttacgtc aacattggtc aggcggagga ctatcgcttt   300
 301 tactggaaag aaagttggta cacgaacact cctgagtggt taggtgaaga agatcctgct   360
 361 tggccaggga actattttgt caaatactgg tacaatgaat ggaaagaaat cgtgttttca   420
 421 tacctcgata gagtcatcga tcagggattc aagggaatct acttagatag gatcgattct   480
 481 tttgaatact gggctcaaga aggtgttatt tcaagacgaa gtgctgccag aaaaatgata   540
 541 aatttcgtgc tggaaattgc tgaatacgtc agagagagaa aaccagacat gctgataata   600
 601 cctcaaaacg gtgagaacat tctcgatttc gatgatggcc agcttgcctc gactgtttcg   660
 661 ggatgggctg ttgagaacct gttttatttg aaaacaatcc ctcttgaaga aaacgagaca   720
 721 aagagtagat tggaatacct cattagattg aatcgaaagg gaaaattcat tctctctgtt   780
 781 gattacgtcg atgacggttc tgattctttt gaaaacataa gccggattct ggattactac   840
 841 gagaaggcca aaagaaatgg atgtataccg tacgctgctc gatccgactt ggaactcgac   900
 901 gaaatgaatg tgatagaggg aatacaaccg ccagaggcat tgaaagatta tgagagtagg   960
 961 acttatcgc   969
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1426348 1427319 1 Glimmer3 score 8.16 poor
Genemark probabilities .72   - poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu