LOADING...
   TM1403;TM1403
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1403    TM1403            JCSG 283264 PDB Deposition 15-FEB-24              PDB id: 4yer

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1403
DESCRIPTIONCASP Target
Description Hidden
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1C3_THEMA
DR SPTR; Q9X1C3 (flat text); Q9X1C3 (good view)
DR GenBank; AAD36474
DR Pfam; PF00005; ABC_tran;
DR Interpro; IPR003593; AAA_ATPase;
DR Interpro; IPR003439; ABC_transporter;
DR Interpro; IPR005894; Drr_ABC_transpt;
DR PDB; 4YER; Identical; 11-MAR-15; ABC TRANSPORTER ATP-BINDING PROTEIN;
DR FFAS; 283264; Fold and function assignment.
DR TVPC; TM1403; Homologs in PDB, JCSG and SG center.
DR OVP; TM1403; Ortholog view popup.
DR TPM; TM1403; Target PDB monitor.
DR FSS; TM1403; Target function coverage.
PROPERTY Residues: 327 aa
Molecule Weight: 37561.79 Dalton
Isoelectric Point: 7.2
Extinction Coefficient: 22920
Gravy Index: -.34
Number of Met residues: 13
Percentage of Met residues: 3.98 %
Number of Cys residues: 2
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 327 aa
>TM1403  TM1403 antibiotic ABC transporter, ATP-binding protein, putative
MEDIIVVENLVKKFGDFEAVKGVSFSVKKGEIFAFLGPNGAGKTTTIHMLTTLLKPTSGK
AWVAGHDVLKEPREVRRKIGIVFQDQSLDRELTAYENMYIHGKIYGYGGEKLKKRILELL
EFVELLEFKDKPVKTFSGGMARRLEIARSLIHEPEVLFLDEPTIGLDPHTRAHMWEYISK
MKKEHNMTIFLTTHYMDEAEQLADRVAIIDHGKIIALGTPTELKRMVGKEIIYVRFSEAV
ECLEGDFIESCRKLPDGRLELNVEDSGRAIPKIFELAQQKGLKIEEITYHKPTLNDVFLH
LTGRELREEGPENSFKTMARMRMRMRR

CDS  cDNA 981 bp
   1 atggaagaca ttatcgtcgt ggaaaatctg gtgaaaaagt tcggagattt cgaagcggtc    60
  61 aaaggagtca gcttctcagt gaagaaagga gaaatcttcg cttttcttgg tccaaacggt   120
 121 gcgggaaaaa ccaccaccat tcacatgctc accacgcttc taaaaccgac gagtggaaag   180
 181 gcatgggttg ccggtcatga cgtgctgaaa gaacctcgag aggttagaag aaaaatcggt   240
 241 atagtctttc aggatcaatc actggacaga gagctcaccg cgtatgaaaa catgtacata   300
 301 cacggaaaaa tatacggcta cggtggagaa aaactcaaaa agagaatcct tgaacttctc   360
 361 gagttcgtgg aacttctgga gttcaaagac aaaccggtca aaacgttcag tggtggcatg   420
 421 gcaagaagac tcgaaatagc tcgctccttg atacatgaac cagaagttct ctttctcgac   480
 481 gaacccacta ttggtctcga tccacacaca agagcgcata tgtgggaata catctcgaaa   540
 541 atgaaaaaag aacacaacat gacaatcttt ctcaccaccc attacatgga cgaggcagaa   600
 601 cagcttgctg acagagtggc gatcatagat cacgggaaaa tcatagcact cggaactcca   660
 661 accgagttga agagaatggt cggaaaagag attatctacg tgagattctc tgaagccgtt   720
 721 gaatgtctcg aaggcgactt catagagtcg tgtagaaaac tccccgatgg aaggctggag   780
 781 ctgaatgtgg aagattctgg aagggcgata ccaaagattt tcgaactggc acagcagaag   840
 841 ggtttgaaaa tagaagaaat cacctatcat aaacccacgc tcaacgatgt tttcctccat   900
 901 ctcacaggaa gggagctcag agaggaagga ccggagaact ctttcaaaac catggcaaga   960
 961 atgagaatga ggatgaggag g   981
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1417650 1418633 3 Glimmer3 score 12.93 good
Genemark probabilities .95   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu