LOADING...
   TM1394;TM1394
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1394    TM1394            JCSG 283255 PDB Deposition 04-NOV-30              PDB id: 1vq0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1394
DESCRIPTION33 kDa chaperonin (Heat shock protein 33 homolog) (HSP33).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: REDOX REGULATED MOLECULAR CHAPERONE. PROTECTS BOTH
THERMALLY UNFOLDING AND OXIDATIVELY DAMAGED PROTEINS FROM
IRREVERSIBLE AGGREGATION. PLAYS AN IMPORTANT ROLE IN THE BACTERIAL
DEFENSE SYSTEM TOWARD OXIDATIVE STRESS (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- PTM: UNDER OXIDIZING CONDITIONS TWO DISULFIDE BONDS ARE FORMED
INVOLVING THE REACTIVE CYSTEINES. UNDER REDUCING CONDITIONS ZINC
IS BOUND TO THE REACTIVE CYSTEINES AND THE PROTEIN IS INACTIVE (BY
SIMILARITY).
-!- SIMILARITY: BELONGS TO THE HSP33 FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; HSLO_THEMA
DR SPTR; Q9X1B4 (flat text); Q9X1B4 (good view)
DR GenBank; AAD36465
DR Pfam; PF01430; HSP33;
DR Interpro; IPR000397; Hsp33;
DR PDB; 1VQ0; Identical; 14-DEC-04; 33 KDA CHAPERONIN;
DR PDB; 1VZY; Highly similar; 06-OCT-04; 33 KDA CHAPERONIN;
DR FFAS; 283255; Fold and function assignment.
DR TVPC; TM1394; Homologs in PDB, JCSG and SG center.
DR OVP; TM1394; Ortholog view popup.
DR TPM; TM1394; Target PDB monitor.
DR FSS; TM1394; Target function coverage.
PROPERTY Residues: 290 aa
Molecule Weight: 32538.84 Dalton
Isoelectric Point: 5.33
Extinction Coefficient: 28420
Gravy Index: -.12
Number of Met residues: 5
Percentage of Met residues: 1.72 %
Number of Cys residues: 4
Percentage of Cys residues: 1.38 %
SEQUENCE  amino acids 290 aa
>TM1394  TM1394 conserved hypothetical protein
MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW
TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLG
LKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTL
EQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIKYKCDCNREKAKN
ALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDSGS

CDS  cDNA 870 bp
   1 atgatttact atggcacgat gttcgatcac aaggtgagat tttcgatcgt tcgaatgaga    60
  61 gaagtggtgg aagaggctcg aaacaggcac gccctttcat acctcgccac ggtggtactc   120
 121 ggaagagccc tcatcggtgc ggctcttgta acaccatggc tcgccgaaaa agaaaggtgg   180
 181 acgctggaca tagagggaaa cgggccaata aggagagtcg ttgcacagtc gaccagcgaa   240
 241 ttcactgtca ggggatatgt ggcaaatccc aaggtggaac tgcccctaaa tgaaaaggga   300
 301 aagttcgatg tcgccggtgc tatcggtcag ggtgttctca gagtggtaag agatctggga   360
 361 ttgaaaactc cctttgtctc tcaggtgcct ctggtgagcg gtgagatcgc cgaagacctg   420
 421 gcttattatt tcgcggtttc tgaacagata ccatccgctt tttccatcgg tgttcttgtg   480
 481 gactcagacg gtgtgaagat cgcgggagga ttcgccgtcc aaatcatcga tcgcactctt   540
 541 gaacaggaga aggtggagat gatagagaaa aacatcaaaa accttcccag tatatcaaaa   600
 601 cttttccagg aagcagaacc tctggacgtt ctggaaagaa tattcggtga gaaggtaggg   660
 661 ttcgtcgaaa cagcggaaat aaagtacaaa tgcgattgca acagggaaaa agccaaaaac   720
 721 gcccttctag tcctggacaa aaaagaattg gaagatatgc gaaaagaagg gaagggagaa   780
 781 gtcgtctgta agtggtgtaa cacaagatac gttttctcag aggaggaatt agaagaactc   840
 841 ctcaagttca aggtagatga ctctggttcc   870
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1408561 1409433 1 Glimmer3 score 9.73 poor
Genemark probabilities .94   .58 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu