LOADING...
   TM1393;TM1393
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1393    TM1393            JCSG 283254 PDB Deposition 04-OCT-14              PDB id: 1vpa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1393
DESCRIPTION2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CATALYZES THE FORMATION OF 4-DIPHOSPHOCYTIDYL-2C-
METHYL-
D-ERYTHRITOL FROM CTP AND 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE (BY
SIMILARITY).
-!- CATALYTIC ACTIVITY: CTP + 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE =
DIPHOSPHATE + 4-(CYTIDINE 5'-DIPHOSPHO)-2-C-METHYL-D-ERYTHRITOL.
-!- PATHWAY: NONMEVALONATE TERPENOID BIOSYNTHESIS PATHWAY; THIRD
STEP.
-!- SIMILARITY: BELONGS TO THE ISPD FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; ISPD_THEMA
DR SPTR; Q9X1B3 (flat text); Q9X1B3 (good view)
DR GenBank; AAD36464
DR Pfam; PF01128; IspD;
DR Interpro; IPR008233; DPCME_synth;
DR Interpro; IPR001228; ISPD_synthase;
DR PDB; 1VPA; Identical; 02-NOV-04; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRANSFERASE;
DR PDB; 2PX7; Highly similar; 12-JUN-07; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRANSFERASE;
DR PDB; 3OKR; Highly similar; 06-OCT-10; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRAN CHAIN: A,;
DR PDB; 3Q7U; Highly similar; 04-MAY-11; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLTRANSF CHAIN: A,;
DR PDB; 3Q80; Highly similar; 04-MAY-11; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLTRANSF CHAIN: A,;
DR PDB; 2XWN; Highly similar; 27-APR-11; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRAN CHAIN: A,;
DR PDB; 2XWL; Highly similar; 27-APR-11; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRAN CHAIN: A,;
DR PDB; 2XWM; Highly similar; 27-APR-11; 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE CYTIDYLYLTRAN CHAIN: A,;
DR KEGG; 2.7.7.60; Enzyme page
DR FFAS; 283254; Fold and function assignment.
DR TVPC; TM1393; Homologs in PDB, JCSG and SG center.
DR OVP; TM1393; Ortholog view popup.
DR TPM; TM1393; Target PDB monitor.
DR FSS; TM1393; Target function coverage.
PROPERTY Residues: 222 aa
Molecule Weight: 25368.95 Dalton
Isoelectric Point: 6.94
Extinction Coefficient: 23950
Gravy Index: -.26
Number of Met residues: 3
Percentage of Met residues: 1.35 %
Number of Cys residues: 1
Percentage of Cys residues: 0.45 %
SEQUENCE  amino acids 222 aa
>TM1393  TM1393 conserved hypothetical protein
MNVAILLAAGKGERMSENVPKQFLEIEGRMLFEYPLSTFLKSEAIDGVVIVTRREWFEVV
EKRVFHEKVLGIVEGGDTRSQSVRSALEFLEKFSPSYVLVHDSARPFLRKKHVSEVLRRA
RETGAATLALKNSDALVRVENDRIEYIPRKGVYRILTPQAFSYEILKKAHENGGEWADDT
EPVQKLGVKIALVEGDPLCFKVTFKEDLELARIIAREWERIP

CDS  cDNA 666 bp
   1 atgaacgtag cgattctcct tgcagcggga aaaggtgaaa gaatgtctga aaacgttcca    60
  61 aaacagttcc tcgagataga gggaaggatg cttttcgagt atccgctttc cacgtttttg   120
 121 aaaagtgaag cgatagatgg tgttgtgata gtgacacgaa gagagtggtt cgaagttgta   180
 181 gagaaaagag tgttccacga aaaagtactc ggaattgtcg agggtggaga tacacgaagc   240
 241 cagagtgtga gaagcgccct cgaatttctt gaaaagttct ctccctctta cgttctcgta   300
 301 cacgactcag cacggccgtt tctgaggaag aaacacgtgt cggaggttct cagaagagcc   360
 361 cgcgaaacgg gagcggcaac cctcgcgttg aagaattccg acgcgctcgt aagagttgag   420
 421 aacgacagaa tagaatacat cccaagaaaa ggagtgtaca gaattcttac accgcaggct   480
 481 ttttcttacg agattttgaa aaaggcccat gaaaatggtg gcgaatgggc agacgacacg   540
 541 gaacctgttc aaaagctcgg agtgaaaata gccttggtcg agggagatcc tttgtgtttc   600
 601 aaagtgacgt ttaaagaaga cctggaactg gcgagaatca tcgccagaga atgggagagg   660
 661 atacca   666
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1407896 1408564 2 Glimmer3 score 10.96 poor
Genemark probabilities .88   .84 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu