LOADING...
   TM1389;TM1389
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1389    TM1389            JCSG 283250 PDB Deposition 05-AUG-30              PDB id: 2avn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1389
DESCRIPTIONUbiquinone/menaquinone biosynthesis methyltransferase-related protein.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1A9_THEMA
DR SPTR; Q9X1A9 (flat text); Q9X1A9 (good view)
DR GenBank; AAD36459
DR Pfam; PF08241; Methyltransf_11;
DR Pfam; PF08242; Methyltransf_12;
DR Interpro; IPR000515; BPD_transp;
DR Interpro; IPR001023; Hsp70;
DR Interpro; IPR000051; SAM_bind;
DR Interpro; IPR004033; UbiE/COQ5mtfrase;
DR PDB; 2AVN; Identical; 18-OCT-05; UBIQUINONE/MENAQUINONE BIOSYNTHESIS METHYLTRANSFE RELATED PR;
DR PDB; 1XXL; Highly similar; 23-NOV-04; YCGJ PROTEIN;
DR PDB; 2GLU; Highly similar; 18-APR-06; YCGJ;
DR PDB; 1WZN; Highly similar; 14-MAR-06; SAM-DEPENDENT METHYLTRANSFERASE;
DR PDB; 2GS9; Highly similar; 13-MAR-07; HYPOTHETICAL PROTEIN TT1324;
DR FFAS; 283250; Fold and function assignment.
DR TVPC; TM1389; Homologs in PDB, JCSG and SG center.
DR OVP; TM1389; Ortholog view popup.
DR TPM; TM1389; Target PDB monitor.
DR FSS; TM1389; Target function coverage.
PROPERTY Residues: 248 aa
Molecule Weight: 28809.44 Dalton
Isoelectric Point: 5.16
Extinction Coefficient: 40910
Gravy Index: -.33
Number of Met residues: 5
Percentage of Met residues: 2.02 %
Number of Cys residues: 1
Percentage of Cys residues: 0.40 %
SEQUENCE  amino acids 248 aa
>TM1389  TM1389 ubiquinone/menaquinone biosynthesis methyltransferase-related protein
MKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFL
QERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKD
KAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSY
AFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFF
VLKKKRGA

CDS  cDNA 744 bp
   1 atgaaactga ggtcatggga attctacgac agaatagcaa gagcgtacga cagtatgtac    60
  61 gaaacaccga agtggaagct ctatcacaga ctgatcggat ctttcttaga ggagtatttg   120
 121 aaaaacccct gcagagttct cgatctcggt ggaggaaccg gaaagtggag tctgttcttg   180
 181 caggaaagag gtttcgaagt agttctcgtc gatccatcga aagagatgct ggaggtggcg   240
 241 agggaaaagg gggttaaaaa cgtcgttgaa gccaaagcgg aagatctccc ctttccttca   300
 301 ggtgctttcg aagcagttct cgctctcggt gacgttctaa gctacgttga aaacaaggat   360
 361 aaagcgtttt cagagataag aagagtgctt gtacccgatg gattgttgat agcaaccgta   420
 421 gacaactttt acactttcct tcagcagatg atcgagaaag acgcgtggga tcaaataaca   480
 481 cgctttttga aaacacaaac cacgagcgtg ggaaccacac tcttttcttt caattcttac   540
 541 gccttcaaac cagaggatct ggactctctg gaaggattcg aaacggtaga tatccgtgga   600
 601 atcggtgtga tggaataccc agacgaacga atcagtgaaa gggaagaaac catctttcgg   660
 661 ctggaacagg aactttcaag ggacagaaac atcatctgga aggccgatca tatattcttc   720
 721 gttttgaaaa agaaaagagg agcc   744
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1403074 1403820 1 Glimmer3 score 13.88 good
Genemark probabilities .89   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu