LOADING...
   TM1387;TM1387
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1387    TM1387            JCSG 283248 PDB Deposition 06-APR-24              PDB id: 2grj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1387
DESCRIPTIONDephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: CATALYZES THE PHOSPHORYLATION OF THE 3'-HYDROXYL GROUP
OF DEPHOSPHOCOENZYME A TO FORM COENZYME A (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: ATP + DEPHOSPHO-COA = ADP + COA.
-!- PATHWAY: COENZYME A (COA) BIOSYNTHESIS; FIFTH (LAST) STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE COAE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; COAE_THEMA
DR SPTR; Q9X1A7 (flat text); Q9X1A7 (good view)
DR GenBank; AAD36457
DR Pfam; PF01121; CoaE;
DR Interpro; IPR001977; Depp_CoAkinase;
DR PDB; 2GRJ; Identical; 23-MAY-06; DEPHOSPHO-COA KINASE;
DR PDB; 2IF2; Highly similar; 03-OCT-06; DEPHOSPHO-COA KINASE;
DR PDB; 2F6R; Highly similar; 27-DEC-05; BIFUNCTIONAL COENZYME A SYNTHASE;
DR PDB; 4TTP; Highly similar; 10-DEC-14; DEPHOSPHO-COA KINASE;
DR PDB; 4TTQ; Highly similar; 10-DEC-14; DEPHOSPHO-COA KINASE;
DR PDB; 4TTR; Highly similar; 10-DEC-14; DEPHOSPHO-COA KINASE;
DR PDB; 1VHL; Highly similar; 30-DEC-03; DEPHOSPHO-COA KINASE;
DR PDB; 1VHT; Highly similar; 30-DEC-03; DEPHOSPHO-COA KINASE;
DR KEGG; 2.7.1.24; Enzyme page
DR FFAS; 283248; Fold and function assignment.
DR TVPC; TM1387; Homologs in PDB, JCSG and SG center.
DR OVP; TM1387; Ortholog view popup.
DR TPM; TM1387; Target PDB monitor.
DR FSS; TM1387; Target function coverage.
PROPERTY Residues: 180 aa
Molecule Weight: 20329.93 Dalton
Isoelectric Point: 9
Extinction Coefficient: 6990
Gravy Index: -.19
Number of Met residues: 4
Percentage of Met residues: 2.22 %
Number of Cys residues: 2
Percentage of Cys residues: 1.11 %
SEQUENCE  amino acids 180 aa
>TM1387  TM1387 conserved hypothetical protein
MVIGVTGKIGTGKSTVCEILKNKYGAHVVNVDRIGHEVLEEVKEKLVELFGGSVLEDGKV
NRKKLAGIVFESRENLKKLELLVHPLMKKRVQEIINKTSGLIVIEAALLKRMGLDQLCDH
VITVVASRETILKRNREADRRLKFQEDIVPQGIVVANNSTLEDLEKKVEEVMKLVWEKRE

CDS  cDNA 540 bp
   1 atggtgatcg gtgttacagg aaagatagga acgggaaagt ccaccgtctg tgagatttta    60
  61 aagaacaaat atggagccca cgttgtgaac gtggatagaa taggccatga agtgctcgaa   120
 121 gaagtgaagg aaaagctcgt cgagcttttc ggaggatctg ttctggaaga cgggaaagta   180
 181 aaccgaaaaa aactcgctgg catcgtcttc gaatcacgcg aaaacctgaa gaagctcgaa   240
 241 ttgctcgtcc atcccttgat gaagaagagg gtacaggaaa taataaacaa aacgagcggc   300
 301 ctcatagtaa tagaggccgc tcttttgaaa aggatgggac tggatcagct gtgcgatcac   360
 361 gtcatcacag tagtcgcaag cagagagacg attctgaaga gaaacagaga agccgacaga   420
 421 cgtttgaagt ttcaggaaga catcgttcca cagggaatag tagtagcgaa caattccact   480
 481 ctcgaagatc tcgaaaagaa ggtagaggaa gtgatgaaac tcgtatggga gaaacgagaa   540
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1402026 1402568 3 Glimmer3 score 14.2 good
Genemark probabilities .92   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu