LOADING...
   TM1385;TM1385
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1385    TM1385            JCSG 283246 PDB Deposition 07-JUN-11              PDB id: 2q8n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1385
DESCRIPTIONGlucose-6-phosphate isomerase (EC 5.3.1.9) (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI).
ORGANISMThermotoga maritima
COMMENT-!- CATALYTIC ACTIVITY: D-GLUCOSE 6-PHOSPHATE = D-FRUCTOSE 6-
PHOSPHATE.
-!- PATHWAY: INVOLVED IN GLYCOLYSIS AND IN GLUCONEOGENESIS.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE GPI FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; G6PI_THEMA
DR SPTR; Q9X1A5 (flat text); Q9X1A5 (good view)
DR GenBank; AAD36455
DR Pfam; PF00342; PGI;
DR Interpro; IPR001672; G6P_Isomerase;
DR PDB; 2Q8N; Identical; 19-JUN-07; GLUCOSE-6-PHOSPHATE ISOMERASE;
DR PDB; 1ZZG; Highly similar; 14-JUN-06; GLUCOSE-6-PHOSPHATE ISOMERASE;
DR PDB; 3IFS; Highly similar; 11-AUG-09; GLUCOSE-6-PHOSPHATE ISOMERASE;
DR PDB; 2PGI; Highly similar; 15-JUN-99; PHOSPHOGLUCOSE ISOMERASE;
DR PDB; 1B0Z; Highly similar; 10-NOV-99; PROTEIN (PHOSPHOGLUCOSE ISOMERASE);
DR PDB; 1C7Q; Highly similar; 13-SEP-00; PHOSPHOGLUCOSE ISOMERASE;
DR PDB; 1C7R; Highly similar; 13-SEP-00; PHOSPHOGLUCOSE ISOMERASE;
DR PDB; 3FF1; Highly similar; 03-FEB-09; GLUCOSE-6-PHOSPHATE ISOMERASE;
DR KEGG; 5.3.1.9; Enzyme page
DR FFAS; 283246; Fold and function assignment.
DR TVPC; TM1385; Homologs in PDB, JCSG and SG center.
DR OVP; TM1385; Ortholog view popup.
DR TPM; TM1385; Target PDB monitor.
DR FSS; TM1385; Target function coverage.
PROPERTY Residues: 448 aa
Molecule Weight: 50489.84 Dalton
Isoelectric Point: 5.02
Extinction Coefficient: 54320
Gravy Index: -.27
Number of Met residues: 14
Percentage of Met residues: 3.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 448 aa
>TM1385  TM1385 glucose-6-phosphate isomerase (pgi)
MSLKFDFSNLFEPNISGGLTDEDVKSVEEKVTSAVRNFVENTPDFAKLDRSWIDSVKSLE
DWIINFDTVVVLGIGGSGLGNLALHYSLRPLNWNEMTREERNGYARVFVVDNVDPDLMSS
VLDRIDPKTTLFNVISKSGSTAEVMATYSIARGILEAYGLDPREHMLITTDPEKGFLRKL
VKEEGFRSLEVPPGVGGRFSVLTPVGLLSAMAEGIDIDELHEGAKDAFEKSMKENILENP
AAMIALTHYLYLNKGKSISVMMAYSNRMIYLVDWYRQLWAESLGKRYNLKGEEVFTGQTP
VKALGATDQHSQIQLYNEGPNDKVITFLRVENFDREIVIPETGRAELSYLARKKLSELLL
AEQTGTEEALRENNRPNMRVTFDGLTPYNVGQFFAYYEAATAFMGYLLEINPFDQPGVEL
GKKITFALMGREGYTYEIKERSKKVIIE

CDS  cDNA 1344 bp
   1 atgagtttaa aattcgactt ttccaatttg tttgaaccga acatctccgg tggtttgaca    60
  61 gatgaagatg taaaaagtgt agaggagaaa gttacaagtg cagttcgaaa ctttgtagaa   120
 121 aacactcccg attttgcaaa gctggacaga agctggatcg attctgttaa atctctcgag   180
 181 gactggataa taaacttcga tacggtcgtt gtgctgggaa ttggaggttc tggacttgga   240
 241 aacctggccc ttcactactc cctcaggcct ttgaactgga acgagatgac cagagaggag   300
 301 agaaacggat acgccagagt gtttgtggtg gacaacgtag atccagatct catgagctct   360
 361 gttctggaca gaatcgatcc caaaacaact cttttcaacg tgatatcgaa atccggttcc   420
 421 accgctgaag taatggcgac ctattcgata gcacgtggga tcctcgaagc ttatggacta   480
 481 gatccaagag aacacatgct catcacaaca gacccggaaa agggcttttt gagaaaactc   540
 541 gtgaaagaag aaggtttcag aagtctcgaa gtgcctcctg gagtgggagg aaggttcagc   600
 601 gttctcacac ctgttggcct cctctcagcc atggcggaag gcatagacat agacgaactg   660
 661 cacgaaggtg caaaggatgc cttcgagaag agcatgaaag agaacatcct tgaaaatcca   720
 721 gcggcaatga tagcactcac acactacctc tacttgaata aaggaaagtc catttctgtg   780
 781 atgatggcgt attcgaacag aatgatctat cttgtggact ggtacagaca gctctgggcg   840
 841 gaaagtcttg gaaaaagata caatctcaag ggagaagagg ttttcaccgg tcaaactcct   900
 901 gtgaaagcgc tgggagcgac cgatcagcac tcacagatac agctttacaa cgaagggccg   960
 961 aacgacaagg taataacctt cctgagagtt gaaaacttcg acagagaaat agtgatcccg  1020
1021 gaaaccggaa gagctgaact cagctatctt gcaaggaaga agctctccga actcctcctc  1080
1081 gcagagcaga caggaacaga agaagcactg cgagaaaaca acagaccgaa catgagagtg  1140
1141 acatttgacg gactcacacc gtacaacgtg ggccaattct tcgcttacta cgaggctgcc  1200
1201 accgctttca tgggttatct tcttgagatc aacccgttcg atcagcccgg tgtggagctc  1260
1261 ggaaaaaaga tcacgttcgc tcttatggga agagaaggtt acacttacga aataaaggaa  1320
1321 aggtcgaaga aggtgattat agaa  1344
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1400459 1401805 2 Glimmer3 score 14.24 good
Genemark probabilities .94   .16 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu