LOADING...
   TM1380;TM1380
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1380    TM1380            JCSG 359772 PDB Deposition 05-MAR-29              PDB id: 1z85

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1380
DESCRIPTIONpredicted RNA methyltransferase [alpha/beta knot]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X1A0_THEMA
DR SPTR; Q9X1A0 (flat text); Q9X1A0 (good view)
DR GenBank; AAD36450
DR Pfam; PF04452; Methyltrans_RNA;
DR Interpro; IPR004382; Cons_hypoth46;
DR Interpro; IPR006700; DUF558;
DR PDB; 1Z85; Identical; 12-APR-05; HYPOTHETICAL PROTEIN TM1380;
DR PDB; 2EGV; Highly similar; 04-SEP-07; UPF0088 PROTEIN AQ_165;
DR PDB; 2EGW; Highly similar; 04-SEP-07; UPF0088 PROTEIN AQ_165;
DR KEGG; 2.; Enzyme page
DR FFAS; 283241; Fold and function assignment.
DR TVPC; TM1380; Homologs in PDB, JCSG and SG center.
DR OVP; TM1380; Ortholog view popup.
DR TPM; TM1380; Target PDB monitor.
DR FSS; TM1380; Target function coverage.
PROPERTY Residues: 222 aa
Molecule Weight: 25096.84 Dalton
Isoelectric Point: 8.63
Extinction Coefficient: 11460
Gravy Index: -.2
Number of Met residues: 2
Percentage of Met residues: 0.90 %
Number of Cys residues: 3
Percentage of Cys residues: 1.35 %
SEQUENCE  amino acids 222 aa
>TM1380  TM1380 conserved hypothetical protein
MPHLFYGTAQNGEVIFDEREAHHMRVVRLKEGDVIEATDGNGFSYTCILKSLKKKTAAAK
IVKVEEKEKEPTEKLSVVVPIGRWERTRFLIEKCVELGVDEIFFHKFERSQHEISLDKAK
IVVREAAKQCKRYLFPKVSFLEKLEFSGNVITLDLDASQNLLDANLEGSITVVVGPEGGF
SEKERELLRSSTTIVSLGKKILRFETAAILTVGYIALKKQKI

CDS  cDNA 666 bp
   1 gtgcctcacc tcttctacgg aacggctcaa aacggtgagg tgatattcga cgaaagagaa    60
  61 gcacaccaca tgagggtcgt gcgtctgaaa gaaggagatg tgatcgaagc aacggatggg   120
 121 aacggctttt catacacgtg tattctcaaa agcttgaaga aaaaaacggc tgcagccaag   180
 181 atcgtaaagg tggaagagaa agaaaaagaa cccactgaga aattgagcgt tgttgttccg   240
 241 atcggcaggt gggaaagaac acgttttctc atagaaaagt gtgttgaact cggggtggac   300
 301 gagatctttt tccacaaatt tgaaagatcc cagcacgaga tcagcctgga taaggcaaaa   360
 361 atcgttgtta gagaggcagc caagcagtgt aagagatatc tttttccaaa ggtgagtttt   420
 421 ctggaaaaac tggagttcag tggaaacgtg ataacactag atctggatgc ctctcaaaac   480
 481 ctgctcgacg cgaacttaga aggctcgata acggtggtgg tcggtcctga gggagggttc   540
 541 tctgagaaag aaagagaatt actgagatct tctacaacca ttgtgagtct tggaaaaaag   600
 601 atcctcagat tcgaaacagc tgcaatattg accgttggat acatcgcttt aaaaaaacaa   660
 661 aaaatc   666
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1397498 1398166 2 Glimmer3 score 10.84 poor
Genemark probabilities .9   .88 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu