LOADING...
   TM1367;TM1367
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1367    TM1367            JCSG 283228 PDB Deposition 08-OCT-27              PDB id: 1zx8, 2ka0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1367
DESCRIPTIONProtein from DUF369 with an atypical cyclophilin (peptidylprolyl isomerase) fold. Putative peptidylprolyl cis-trans isomerase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X187_THEMA
DR SPTR; Q9X187 (flat text); Q9X187 (good view)
DR GenBank; AAD36437
DR Pfam; PF04126; Cyclophil_like;
DR Interpro; IPR007256; DUF369;
DR PDB; 1ZX8; Identical; 26-JUL-05; HYPOTHETICAL PROTEIN TM1367;
DR PDB; 2KA0; Identical; 13-JAN-09; UNCHARACTERIZED PROTEIN TM1367;
DR PDB; 2NNZ; Highly similar; 28-AUG-07; HYPOTHETICAL PROTEIN;
DR FFAS; 283228; Fold and function assignment.
DR TVPC; TM1367; Homologs in PDB, JCSG and SG center.
DR OVP; TM1367; Ortholog view popup.
DR TPM; TM1367; Target PDB monitor.
DR FSS; TM1367; Target function coverage.
PROPERTY Residues: 124 aa
Molecule Weight: 13922.43 Dalton
Isoelectric Point: 4.86
Extinction Coefficient: 15470
Gravy Index: -.15
Number of Met residues: 3
Percentage of Met residues: 2.42 %
Number of Cys residues: 2
Percentage of Cys residues: 1.61 %
SEQUENCE  amino acids 124 aa
>TM1367  TM1367 conserved hypothetical protein
MRVELLFESGKCVIDLNEEYEVVKLLKEKIPFESVVNTWGEEIYFSTPVNVQKMENPREV
VEIGDVGYWPPGKALCLFFGKTPMSDDKIQPASAVNVIGKIVEGLEDLKKIKDGEKVAVR
FASS

CDS  cDNA 372 bp
   1 atgagagttg aactcctctt tgaaagtgga aaatgtgtga tagatctcaa tgaggaatac    60
  61 gaggtcgtca aattgttgaa ggaaaaaatt ccattcgaaa gtgtcgtgaa cacttggggc   120
 121 gaggagatat acttctcaac tcctgtgaac gttcagaaga tggaaaaccc aagggaagta   180
 181 gttgaaatag gagacgttgg atactggcct ccgggaaaag cgctgtgtct gttctttggg   240
 241 aaaactccca tgagcgatga caaaattcaa ccagcgagtg ctgtaaacgt gataggaaag   300
 301 atcgtggaag ggctggaaga tctgaaaaaa ataaaagacg gcgagaaggt cgccgtcaga   360
 361 tttgcatcct ca   372
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1385210 1385584 -2 Glimmer3 score 13.31 good
Genemark probabilities .9   .83 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu