LOADING...
   TM1347;TM1347
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1347    TM1347            JCSG 283208 PDB Deposition 05-FEB-22              PDB id: 1vrd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1347
DESCRIPTIONInosine-5'-monophosphate dehydrogenase.
ORGANISMThermotoga maritima
COMMENT Annotation is full and correct.
EC number is added. Very conservative protein. By sequence similarity: consistently annotated in KEGG, ERGO:
inosine-5'-monophosphate dehydrogenase ( EC 1.1.1.205)
Strongly supportive genome and functional context:
TM1347 and TM1345 - Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8) - form on a chromosome a conserved cluster of enzymes involved in the same pathway of Purine metabolism ( KEGG MAP00230 ).
Indirect functional couplings to:
TM1379 - Seryl-tRNA synthetase (EC 6.1.1.11)
TM1446 - GTP-binding protein
TM1768 - Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)
TM1820 - GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2 )
TM1347 and TM1820 participate in two steps of the pathway from Inosine 5'-monophosphate to Guanosine 5'-monophosphate via xanthosine 5'-phosphate.
DR UNIPROT; Q9X168_THEMA
DR SPTR; Q9X168 (flat text); Q9X168 (good view)
DR GenBank; AAD36418
DR Pfam; PF00478; IMPDH;
DR Pfam; PF00571; CBS;
DR Interpro; IPR000644; CBS_domain;
DR Interpro; IPR003009; FMN_enzyme;
DR Interpro; IPR001093; IMPDh/GMPRtase;
DR Interpro; IPR005990; IMP_dehyd;
DR PDB; 1VRD; Identical; 15-MAR-05; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 3TSD; Highly similar; 05-OCT-11; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 3USB; Highly similar; 07-DEC-11; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 1ZFJ; Highly similar; 29-MAR-00; INOSINE MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 4AVF; Highly similar; 09-JAN-13; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 3ZFH; Highly similar; 16-JAN-13; INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 4DQW; Highly similar; 06-MAR-13; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR PDB; 4FXS; Highly similar; 25-JUL-12; INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE;
DR KEGG; 1.1.1.205; Enzyme page
DR FFAS; 283208; Fold and function assignment.
DR TVPC; TM1347; Homologs in PDB, JCSG and SG center.
DR OVP; TM1347; Ortholog view popup.
DR TPM; TM1347; Target PDB monitor.
DR FSS; TM1347; Target function coverage.
PROPERTY Residues: 482 aa
Molecule Weight: 52011.54 Dalton
Isoelectric Point: 6.37
Extinction Coefficient: 24870
Gravy Index: -.08
Number of Met residues: 14
Percentage of Met residues: 2.90 %
Number of Cys residues: 2
Percentage of Cys residues: 0.41 %
SEQUENCE  amino acids 482 aa
>TM1347  TM1347 inosine-5'-monophosphate dehydrogenase (guaB)
MKEALTFDDVLLVPQYSEVLPKDVKIDTRLTRQIRINIPLVSAAMDTVTEAALAKALARE
GGIGIIHKNLTPDEQARQVSIVKKTENGIIYDPITVTPDMTVKEAIDLMAEYKIGGLPVV
DEEGRLVGLLTNRDVRFEKNLSKKIKDLMTPREKLIVAPPDISLEKAKEILHQHRIEKLP
LVSKDNKLVGLITIKDIMSVIEHPNAARDEKGRLLVGAAVGTSPETMERVEKLVKAGVDV
IVIDTAHGHSRRVIETLEMIKADYPDLPVVAGNVATPEGTEALIKAGADAVKVGVGPGSI
CTTRVVAGVGVPQLTAVMECSEVARKYDVPIIADGGIRYSGDIVKALAAGAESVMVGSIF
AGTEEAPGETILYQGRKYKAYRGMGSLGAMRSGSADRYGQEGENKFVPEGIEGMVPYKGT
VKDVVHQLVGGLRSGMGYIGARTIKELQEKAVFVKITPAGVKESHPHDIIITKESPNYWV
QA

CDS  cDNA 1446 bp
   1 atgaaagaag ccctgacctt tgacgatgtg ctgcttgttc cacagtacag cgaagtcctt    60
  61 ccaaaagacg tgaaaataga caccaggctc acaagacaga tacgaataaa tataccactt   120
 121 gtgagtgccg ccatggacac agtgaccgaa gcggctctgg caaaggctct tgcaagagaa   180
 181 ggtggcattg gaatcattca caagaatctc actcccgatg aacaggcgcg ccaggtatcg   240
 241 atcgtgaaga agaccgaaaa cggcatcata tacgatccta tcaccgtaac cccggatatg   300
 301 acggtgaaag aagcaattga tctcatggca gagtacaaaa taggtggact tcccgttgtg   360
 361 gacgaggagg gaaggcttgt tggcctgctc acaaacagag atgtcaggtt cgaaaagaac   420
 421 ctttcaaaga agataaaaga tctgatgaca ccaagagaaa agctcatcgt ggcccctcca   480
 481 gacatctccc tcgaaaaagc aaaagaaatt ctccaccagc acagaataga gaaacttccc   540
 541 ctcgtctcaa aagacaacaa gctcgttgga ttgatcacca tcaaggacat aatgagtgtg   600
 601 atagaacatc ccaacgcggc gagggacgaa aagggaaggc ttctcgtggg tgcagcggtt   660
 661 ggaacgagtc ctgaaaccat ggaaagggtg gaaaagctcg taaaagcggg tgtggatgtg   720
 721 atcgtcatag ataccgctca cggtcactcc agaagagtga tagagaccct cgagatgata   780
 781 aaagcagact acccggattt gccggtagtg gccggaaatg tggcgacccc ggaaggaacg   840
 841 gaggcgctca taaaggcggg agcggacgct gtgaaagtag gtgtgggtcc cggatcgatc   900
 901 tgtacaacga gagtggtagc tggtgttggt gttccgcagc tcacagccgt tatggaatgt   960
 961 tctgaagttg cgagaaagta cgacgttccc atcatagcgg atggaggaat cagatactct  1020
1021 ggagacattg tgaaagcact tgcagccggt gccgagagtg tcatggtcgg aagtatcttt  1080
1081 gccggtaccg aagaggcacc gggagaaacg atactgtatc agggtagaaa gtacaaggcc  1140
1141 tacagaggta tgggaagcct tggcgctatg agatctggaa gtgcggacag atacggtcag  1200
1201 gaaggggaaa acaagtttgt ccccgaagga atagagggta tggtgccgta caaaggaacc  1260
1261 gtaaaagacg tggtgcatca gcttgtgggc ggactcagat ccggtatggg atacatcggt  1320
1321 gccagaacaa taaaagaact ccaggaaaag gcagtcttcg tgaaaatcac tccagctgga  1380
1381 gtgaaagaaa gccatccaca cgacatcatc ataacgaaag aatctccgaa ctactgggtc  1440
1441 caggct  1446
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1366267 1367715 1 Glimmer3 score 12.73 good
Genemark probabilities .97   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu