LOADING...
   TM1293;TM1293
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1293    TM1293            JCSG 283157 PDB Deposition 04-AUG-04              PDB id: 1vlm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1293
DESCRIPTIONSAM-dependent methyltransferase, possible histamine N-methyltransferase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X119_THEMA
DR SPTR; Q9X119 (flat text); Q9X119 (good view)
DR GenBank; AAD36367
DR Pfam; PF08241; Methyltransf_11;
DR Pfam; PF08242; Methyltransf_12;
DR Interpro; IPR000051; SAM_bind;
DR Interpro; IPR004033; UbiE/COQ5mtfrase;
DR PDB; 1VLM; Identical; 24-AUG-04; SAM-DEPENDENT METHYLTRANSFERASE;
DR PDB; 2GS9; Highly similar; 13-MAR-07; HYPOTHETICAL PROTEIN TT1324;
DR PDB; 4PNE; Highly similar; 18-FEB-15; METHYLTRANSFERASE-LIKE PROTEIN;
DR FFAS; 283157; Fold and function assignment.
DR TVPC; TM1293; Homologs in PDB, JCSG and SG center.
DR OVP; TM1293; Ortholog view popup.
DR TPM; TM1293; Target PDB monitor.
DR FSS; TM1293; Target function coverage.
PROPERTY Residues: 207 aa
Molecule Weight: 23917.62 Dalton
Isoelectric Point: 8.4
Extinction Coefficient: 21430
Gravy Index: -.22
Number of Met residues: 5
Percentage of Met residues: 2.42 %
Number of Cys residues: 2
Percentage of Cys residues: 0.97 %
SEQUENCE  amino acids 207 aa
>TM1293  TM1293 conserved hypothetical protein
MWHIFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVE
PSERMAEIARKRGVFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKG
GYLIVGIVDRESFLGREYEKNKEKSVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKH
PSELSEIEPVKEGYGEGAFVVIRGTKK

CDS  cDNA 621 bp
   1 gtgtggcata tctttgaacg tttcgtgaac gaatacgagc ggtggtttct ggtccacagg    60
  61 ttcgcgtacc tttccgaact gcaagcggtg aagtgccttc ttccagaagg gagaggtgtg   120
 121 gaaataggtg taggaacggg aagatttgcc gttcctctca aaataaagat cggagtggaa   180
 181 ccttcagagc gcatggcaga gatagcaaga aagcgaggcg tgttcgtttt gaagggtaca   240
 241 gcggagaacc ttcccttgaa ggatgaaagc ttcgatttcg cgttgatggt gacaacgatc   300
 301 tgctttgtgg atgatccgga aagggcgttg aaagaagcct atcgtatcct caaaaagggt   360
 361 gggtatctca tcgtcggtat cgtggacagg gagagttttc ttggaagaga atacgaaaaa   420
 421 aacaaagaaa agagcgtttt ctacaaaaac gctcgattct tctcaacgga ggaactgatg   480
 481 gatctgatga gaaaagcggg ttttgaagaa ttcaaagtcg tccaaactct cttcaaacac   540
 541 ccatcggagc tcagtgagat cgaaccggtt aaggaaggct acggtgaagg tgcttttgtg   600
 601 gtgataagag gaacgaagaa a   621
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1319134 1319757 -1 Glimmer3 score 12.57 good
Genemark probabilities .84   .1 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu