LOADING...
   TM1290;TM1290
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1290    TM1290            JCSG 283154 PDB Deposition 03-NOV-06              PDB id: 1rdu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1290
DESCRIPTIONPutative NifB protein from DUF35 family , involved in FeMo-Co biosynthesis [Ribonuclease H-like motif]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X116_THEMA
DR SPTR; Q9X116 (flat text); Q9X116 (good view)
DR GenBank; AAD36364
DR Pfam; PF02579; Nitro_FeMo-Co;
DR Interpro; IPR003731; DUF153;
DR PDB; 1RDU; Identical; 06-JUL-04; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1EO1; Highly similar; 20-DEC-00; HYPOTHETICAL PROTEIN MTH1175;
DR PDB; 2WFB; Highly similar; 26-MAY-10; PUTATIVE UNCHARACTERIZED PROTEIN ORP;
DR PDB; 1T3V; Highly similar; 14-DEC-04; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1O13; Highly similar; 18-DEC-02; PROBABLE NIFB PROTEIN;
DR FFAS; 283154; Fold and function assignment.
DR TVPC; TM1290; Homologs in PDB, JCSG and SG center.
DR OVP; TM1290; Ortholog view popup.
DR TPM; TM1290; Target PDB monitor.
DR FSS; TM1290; Target function coverage.
PROPERTY Residues: 116 aa
Molecule Weight: 12537.39 Dalton
Isoelectric Point: 4.86
Extinction Coefficient: 5960
Gravy Index: -.1
Number of Met residues: 2
Percentage of Met residues: 1.72 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 116 aa
>TM1290  TM1290 conserved hypothetical protein
MARVAIPSVGKDLSSMVSDRFARAEYFIIYDTESGNVEVVENTIADAHGTGPKVVQSLVS
KGVEYLIASNVGRNAFETLKAAGVKVYRFEGGTVQEAIDAFSEGRLEELTTFTREG

CDS  cDNA 348 bp
   1 atggcaaggg tagcgattcc atctgtgggg aaggatctgt cttccatggt gagcgataga    60
  61 ttcgccaggg cagagtattt catcatctat gacacggagt ctggaaatgt ggaagtcgtt   120
 121 gaaaacacca tcgccgatgc gcatgggaca ggcccgaagg ttgttcaaag tctcgtttcg   180
 181 aagggagtag agtatctcat agcctcgaat gtcggcagaa acgcgtttga gactttgaag   240
 241 gcggctggag tgaaggtcta tcggttcgaa ggaggaacgg ttcaggaggc aatcgacgct   300
 301 ttcagcgaag gaaggctcga ggagttgacg accttcacca gagagggg   348
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1316979 1317329 -3 Glimmer3 score 10.08 poor
Genemark probabilities .85   .59 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu