LOADING...
   TM1287;TM1287
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1287    TM1287            JCSG 283151 PDB Deposition 03-JUL-03              PDB id: 1o4t

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1287
DESCRIPTIONputative oxalate decarboxylase (EC 4.1.1.2 ) [double-stranded beta-helix]
ORGANISMThermotoga maritima
COMMENT No genome context.
Function context: oxalate decarboxylase (EC 4.1.1.2 ) is needed in the oxalate -formate pathway in
Thermotoga maritima Glyoxylate and dicarboxylate metabolism (KEGG MAP00630 ).
No genome context.
By similarity:
good score with Mannose-6-phosphate isomerase( Desulfitobacterium hafniense ) (EC 5.3.1.8).
DR UNIPROT; Q9X113_THEMA
DR SPTR; Q9X113 (flat text); Q9X113 (good view)
DR GenBank; AAD36361
DR Pfam; PF07883; Cupin_2;
DR Interpro; IPR007113; Cupin_sup;
DR PDB; 1O4T; Identical; 15-JUL-03; PUTATIVE OXALATE DECARBOXYLASE;
DR KEGG; 4.1.1.2; Enzyme page
DR FFAS; 283151; Fold and function assignment.
DR TVPC; TM1287; Homologs in PDB, JCSG and SG center.
DR OVP; TM1287; Ortholog view popup.
DR TPM; TM1287; Target PDB monitor.
DR FSS; TM1287; Target function coverage.
PROPERTY Residues: 121 aa
Molecule Weight: 13269.49 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 2980
Gravy Index: -.25
Number of Met residues: 6
Percentage of Met residues: 4.96 %
Number of Cys residues: 1
Percentage of Cys residues: 0.83 %
SEQUENCE  amino acids 121 aa
>TM1287  TM1287 conserved hypothetical protein
MKEGTGMVVRSSEITPERISNMRGGKGEVEMAHLLSKEAMHNKARLFARMKLPPGSSVGL
HKHEGEFEIYYILLGEGVFHDNGKDVPIKAGDVCFTDSGESHSIENTGNTDLEFLAVIIL
L

CDS  cDNA 363 bp
   1 atgaaggagg gaacaggtat ggtcgtgaga tcttctgaaa tcacccctga aaggatttct    60
  61 aacatgcgcg gtgggaaagg tgaagtggaa atggcacatc ttctctccaa agaagctatg   120
 121 cacaacaaag caagactctt tgccagaatg aaactccctc ccggatcttc cgtggggctt   180
 181 cacaaacacg agggggaatt cgaaatctac tacatcctct tgggagaagg cgtcttccac   240
 241 gacaacggaa aggacgttcc cataaaagca ggagacgtgt gcttcacgga ttctggagag   300
 301 tctcattcga tagagaatac aggaaacaca gaccttgagt ttctggcggt gatcattctg   360
 361 ctg   363
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1315419 1315784 3 Glimmer3 score - -
Genemark probabilities .72   .2 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu