LOADING...
   TM1272;TM1272
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1272    TM1272            JCSG 283137 PDB Deposition 06-MAR-28              PDB id: 2gi3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1272
DESCRIPTIONGlutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-) (Glu-ADT subunit A).
ORGANISMThermotoga maritima
COMMENT-!- FUNCTION: FURNISHES A MEANS FOR FORMATION OF CORRECTLY CHARGED
GLN-TRNA(GLN) THROUGH THE TRANSAMIDATION OF MISACYLATED GLU-
TRNA(GLN) IN ORGANISMS WHICH LACK GLUTAMINYL-TRNA SYNTHETASE. THE
REACTION TAKES PLACE IN THE PRESENCE OF GLUTAMINE AND ATP THROUGH
AN ACTIVATED GAMMA-PHOSPHO-GLU-TRNA(GLN) (BY SIMILARITY).
-!- CATALYTIC ACTIVITY: ATP + L-GLUTAMYL-TRNA(GLN) + L-GLUTAMINE = ADP
+ PHOSPHATE + L-GLUTAMINYL-TRNA(GLN) + L-GLUTAMATE.
-!- SUBUNIT: HETEROTRIMER OF A, B AND C SUBUNITS (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE AMIDASE FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; GATA_THEMA
DR SPTR; Q9X0Z9 (flat text); Q9X0Z9 (good view)
DR GenBank; AAD36347
DR Pfam; PF01425; Amidase;
DR Interpro; IPR000120; Amidase;
DR Interpro; IPR004412; GatA;
DR PDB; 2GI3; Identical; 11-APR-06; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 3H0L; Highly similar; 21-JUL-09; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 3H0M; Highly similar; 21-JUL-09; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 3H0R; Highly similar; 21-JUL-09; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 2DF4; Highly similar; 18-JUL-06; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 2DQN; Highly similar; 18-JUL-06; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 2F2A; Highly similar; 18-JUL-06; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR PDB; 2G5H; Highly similar; 18-JUL-06; GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT A;
DR KEGG; 6.3.5.; Enzyme page
DR FFAS; 283137; Fold and function assignment.
DR TVPC; TM1272; Homologs in PDB, JCSG and SG center.
DR OVP; TM1272; Ortholog view popup.
DR TPM; TM1272; Target PDB monitor.
DR FSS; TM1272; Target function coverage.
PROPERTY Residues: 475 aa
Molecule Weight: 52525.66 Dalton
Isoelectric Point: 7.59
Extinction Coefficient: 36330
Gravy Index: -.11
Number of Met residues: 13
Percentage of Met residues: 2.74 %
Number of Cys residues: 3
Percentage of Cys residues: 0.63 %
SEQUENCE  amino acids 475 aa
>TM1272  TM1272 glutamyl tRNA-Gln amidotransferase, subunit A (gatA)
MIDLDFRKLTIEECLKLSEEEREKLPQLSLETIKRLDPHVKAFISVRENVSVEKKGKFWG
IPVAIKDNILTLGMRTTCASRILENYESVFDATVVKKMKEAGFVVVGKANLDEFAMGSST
ERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCGVVGYKP
TYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSEIEE
GVSGMKFAVPEEIYEHDIEEGVSERFEEALKLLERLGAKVERVKIPHIKYSVATYYVIAP
AEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYF
NKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFTIPANLAGL
PAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIEKNSPYNENGMFPLPEVKA

CDS  cDNA 1425 bp
   1 gtgatcgatt tggacttcag aaaactcaca atagaagagt gtctgaaact ttccgaagaa    60
  61 gaaagggaga aactcccaca actttccctg gaaaccatca aaagactcga tccacacgtg   120
 121 aaggcgttca tctccgtaag agagaatgtt tccgttgaga agaagggaaa attctgggga   180
 181 attccagttg cgatcaagga caacattctc acactgggca tgagaacgac ctgtgcctcc   240
 241 aggatactcg aaaactacga atccgttttc gatgccacag tggtgaagaa gatgaaggaa   300
 301 gcaggctttg tcgtggttgg gaaggcaaac ctcgatgagt ttgcgatggg ctcgagcacc   360
 361 gaaagatccg cattctttcc cacaagaaac ccctgggacc tggaaagggt tcccggcgga   420
 421 agcagtgggg gttctgccgc ggccgtttct gcaggaatgg tggtggcagc actcggaagc   480
 481 gacacgggag gctctgtgag acagcccgct tccctgtgcg gtgttgttgg gtacaagccc   540
 541 acctacggtc tcgtctcaag gtacggtctt gtagcgtttg caagttctct ggaccagatc   600
 601 ggacccatca caaagaccgt aagagacgct gcaatcctca tggagatcat ctcgggccgg   660
 661 gacgaaaacg atgccacgac ggtgaacagg aaggtggact tcctctcgga gatagaagag   720
 721 ggagtctccg gcatgaagtt tgccgttcct gaagagatct acgaacacga tatagaagaa   780
 781 ggagtttcgg aaagattcga agaggccctg aaacttctcg agagactcgg tgcaaaggtg   840
 841 gagagagtga agatacccca catcaagtac tctgttgcca cctactacgt catcgctcca   900
 901 gccgaggcga gttcaaacct tgccagattc gacggtgtga agtacggcct caggataaaa   960
 961 gagaaaggcc tcagggagat gtacatgaag acaagaaacg tgggcttcgg tgaggaagtg  1020
1021 agaagaagga tcatgatcgg aaccttcacc ctcagcgctg cctactacga agcctatttc  1080
1081 aacaaggcca tgaaagtgag gagaaagatc tccgatgagc tcaacgaggt gctctcgcag  1140
1141 tacgacgcga tcctcactcc cacctccccg gtgacggcct tcaagatcgg agagataaaa  1200
1201 gatcctctca cctactacct catggacatc ttcacgatac ccgcaaacct cgcgggactt  1260
1261 cccgcgatca gtgtgccgtt cgggttctca aacaatctcc ccgttggtgt tcaggtgata  1320
1321 ggcagaaggt tcgcggacgg gaaagtcttc agaatagcga gggccataga gaagaactcc  1380
1381 ccatacaacg aaaacggcat gttcccgctc ccggaggtga aagca  1425
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1297318 1298745 1 Glimmer3 score - -
Genemark probabilities .92   .97 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu