LOADING...
   TM1255;TM1255
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1255    TM1255            JCSG 283120 PDB Deposition 03-JUN-26              PDB id: 1o4s

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1255
DESCRIPTIONAspartate aminotransferase (EC 2.6.1.1) (Transaminase A) (AspAT).
ORGANISMThermotoga maritima
COMMENTGenome context:
Genes (TM1255 - TM1264) make a cluster on a chromosome in a lot of species
---------------------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: L-ASPARTATE + 2-OXOGLUTARATE = OXALOACETATE +
L-GLUTAMATE.
-!- COFACTOR: PYRIDOXAL PHOSPHATE (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO CLASS-I OF PYRIDOXAL-PHOSPHATE-DEPENDENT
AMINOTRANSFERASES.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; AAT_THEMA
DR SPTR; Q9X0Y2 (flat text); Q9X0Y2 (good view)
DR GenBank; AAD36330
DR Pfam; PF00155; Aminotran_1_2;
DR Interpro; IPR001176; ACC_synthase;
DR Interpro; IPR004839; Aminotrans_I/II;
DR Interpro; IPR004838; NHtransf_1_BS;
DR PDB; 1O4S; Identical; 08-JUL-03; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1BKG; Highly similar; 22-JUL-99; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1BJW; Highly similar; 22-JUL-99; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1B5O; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR PDB; 1GCK; Highly similar; 14-NOV-01; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1B5P; Highly similar; 02-SEP-03; PROTEIN (ASPARTATE AMINOTRANSFERASE);
DR PDB; 1GC3; Highly similar; 05-SEP-01; ASPARTATE AMINOTRANSFERASE;
DR PDB; 1GC4; Highly similar; 05-SEP-01; ASPARTATE AMINOTRANSFERASE;
DR KEGG; 2.6.1.1; Enzyme page
DR FFAS; 283120; Fold and function assignment.
DR TVPC; TM1255; Homologs in PDB, JCSG and SG center.
DR OVP; TM1255; Ortholog view popup.
DR TPM; TM1255; Target PDB monitor.
DR FSS; TM1255; Target function coverage.
PROPERTY Residues: 377 aa
Molecule Weight: 42418.71 Dalton
Isoelectric Point: 6.81
Extinction Coefficient: 30370
Gravy Index: -.1
Number of Met residues: 7
Percentage of Met residues: 1.86 %
Number of Cys residues: 2
Percentage of Cys residues: 0.53 %
SEQUENCE  amino acids 377 aa
>TM1255  TM1255 aspartate aminotransferase (aspC-1)
MVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEV
KYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFS
PVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYR
REFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTG
WRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNSYMVQTFKERKNFVVER
LKKMGVKFVEPEGAFYLFFKVRGDDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSI
ERLTEALDRIEDFLNSR

CDS  cDNA 1131 bp
   1 atggtatcca ggagaatatc agagattccc atatcgaaaa ccatggaact cgacgcgaag    60
  61 gccaaagccc tcataaaaaa gggagaagac gtgatcaatc taacggctgg tgagccggat   120
 121 tttcccacac cggaacccgt cgtggaagaa gcggtgagat ttctccagaa aggagaagtg   180
 181 aaatacacag atcctcgtgg tatctacgaa ctcagagagg gtatagcgaa aaggataggc   240
 241 gagagataca aaaaagatat ctcaccggat caggtcgtgg tgacgaatgg agcgaaacag   300
 301 gctctgttca atgctttcat ggcccttctc gatcccggtg acgaagtgat cgtgttttct   360
 361 cccgtctggg tcagctacat tcctcagatc atccttgctg gtggcacggt gaacgtggtt   420
 421 gagacgttca tgagtaaaaa tttccagccc agtctggaag aggtggaagg gcttcttgtt   480
 481 gggaaaacga aagccgttct tatcaactcg ccgaacaatc ccactggtgt ggtgtacaga   540
 541 agagagttcc ttgaaggact tgtgagactt gccaagaaga ggaatttcta cataatcagc   600
 601 gacgaagtct acgattccct tgtttacacg gatgaattca catcgatact cgatgtttct   660
 661 gaaggattcg accggatagt ttacataaac ggcttctcga agtctcactc catgaccggc   720
 721 tggagggtgg gttacctgat atcgagcgaa aaagtagcga ccgctgtgtc gaagatccag   780
 781 tctcacacca cctcctgtat caacacggta gcacagtacg ccgccttgaa ggctctggaa   840
 841 gtggacaact cttacatggt tcagaccttt aaagaaagaa aaaatttcgt ggtggaaaga   900
 901 ttgaaaaaga tgggtgttaa gttcgtggaa ccagaaggtg cgttctacct ctttttcaaa   960
 961 gtccggggtg acgatgtgaa attctgtgaa aggctcctcg aagaaaagaa ggttgcactc  1020
1021 gttccaggat ccgcttttct gaagcctgga tttgtgaggc tttcttttgc cacatctata  1080
1081 gaaagactta cggaggcgct ggatagaatt gaagacttcc tcaattctcg t  1131
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1280673 1281806 3 Glimmer3 score 14.03 good
Genemark probabilities .91   .11 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu