LOADING...
   TM1250;TM1250
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1250    TM1250            JCSG 359807 PDB Deposition 04-JUN-29              PDB id: 1vkz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1250
DESCRIPTIONPhosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase).
ORGANISMThermotoga maritima
COMMENTPerfect genome and functional context: clustering on a chromosome with another enzymes of
De novo Purine biosynthesis subsystem:
TM1244 - Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3)
TM1245 - Phosphoribosylformylglycinamidine synthase, purL subunit (EC 6.3.5.3)
TM1246 - Phosphoribosylformylglycinamidine synthase, purQ subunit (EC 6.3.5.3)
TM1247 - Amidophosphoribosyltransferase (EC 2.4.2.14)
TM1248 - Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)
TM1249 - Phosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) / IMP cyclohydrolase (EC 3.5.4.10)
TM1251 - Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)

-!- CATALYTIC ACTIVITY: ATP + 5-PHOSPHO-D-RIBOSYLAMINE + GLYCINE = ADP
+ PHOSPHATE + N(1)-(5-PHOSPHO-D-RIBOSYL)GLYCINAMIDE.
-!- PATHWAY: DE NOVO PURINE BIOSYNTHESIS; SECOND STEP.
-!- SIMILARITY: BELONGS TO THE GARS FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PUR2_THEMA
DR SPTR; Q9X0X7 (flat text); Q9X0X7 (good view)
DR GenBank; AAD36325
DR Pfam; PF01071; GARS_A;
DR Pfam; PF02843; GARS_C;
DR Pfam; PF02844; GARS_N;
DR Interpro; IPR000115; Gars;
DR PDB; 1VKZ; Identical; 24-AUG-04; PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;
DR PDB; 2YW2; Highly similar; 23-OCT-07; PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;
DR PDB; 2YYA; Highly similar; 30-OCT-07; PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;
DR PDB; 2QK4; Highly similar; 24-JUL-07; TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN ADENOSI CHAIN: A,;
DR PDB; 2IP4; Highly similar; 30-OCT-07; PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;
DR PDB; 3MJF; Highly similar; 26-MAY-10; PHOSPHORIBOSYLAMINE--GLYCINE LIGASE;
DR PDB; 2YRW; Highly similar; 09-OCT-07; PHOSPHORIBOSYLGLYCINAMIDE SYNTHETASE;
DR PDB; 2YRX; Highly similar; 09-OCT-07; PHOSPHORIBOSYLGLYCINAMIDE SYNTHETASE;
DR KEGG; 6.3.4.13; Enzyme page
DR FFAS; 283115; Fold and function assignment.
DR TVPC; TM1250; Homologs in PDB, JCSG and SG center.
DR OVP; TM1250; Ortholog view popup.
DR TPM; TM1250; Target PDB monitor.
DR FSS; TM1250; Target function coverage.
PROPERTY Residues: 400 aa
Molecule Weight: 44323.56 Dalton
Isoelectric Point: 6.11
Extinction Coefficient: 45840
Gravy Index: -.36
Number of Met residues: 8
Percentage of Met residues: 2.00 %
Number of Cys residues: 1
Percentage of Cys residues: 0.25 %
SEQUENCE  amino acids 400 aa
>TM1250  TM1250 phosphoribosylamine--glycine ligase (purD)
MKAVRVHILGSGGREHAIGWAFAKQGYEVHFYPGNAGTKRDGTNHPYEGEKTLKAIPEED
IVIPGSEEFLVEGVSNWRSNVFGPVKEVARLEGSKVYAKRFMKKYGIRTARFEVAETPEE
LREKIKKFSPPYVIKADGLARGKGVLILDSKEETIEKGSKLIIGELIKGVKGPVVIDEFL
AGNELSAMAVVNGRNFVILPFVRDYKRLMDGDRGPNTGGMGSWGPVEIPSDTIKKIEELF
DKTLWGVEKEGYAYRGFLYLGLMLHDGDPYILEYNVRLGDPETEVIVTLNPEGFVNAVLE
GYRGGKMEPVEPRGFAVDVVLAARGYPDAPEKGKEITLPEEGLIFFAGVAEKDGKLVTNG
GRVLHCMGTGETKEEARRKAYELAEKVHFEGKTYRRDIAL

CDS  cDNA 1200 bp
   1 gtgaaagcgg tgagggtaca catactcggt tctggaggaa gggaacacgc gataggatgg    60
  61 gctttcgcaa agcaggggta cgaagtccac ttctatccgg gaaacgccgg aacgaagaga   120
 121 gatggaacga accatcccta tgaaggggaa aaaaccttga aagccattcc cgaagaagac   180
 181 atcgtgatac cgggatccga ggaattcctg gtagaagggg tctcgaactg gagatccaac   240
 241 gtctttggcc cggtgaaaga ggtcgcaagg ctcgaaggat ccaaggtcta tgccaaaagg   300
 301 ttcatgaaga agtacggtat aagaaccgct cgtttcgaag tggcagaaac tccagaggaa   360
 361 ttgagagaga agataaaaaa attctctcct ccttacgtga taaaggcgga cgggctcgct   420
 421 cgaggaaagg gtgttctgat cctcgactct aaggaagaaa ccatcgaaaa gggatcgaaa   480
 481 ctcatcatcg gagagctcat aaaaggtgtg aaaggccctg ttgtgataga tgaatttctc   540
 541 gccgggaacg agctttccgc catggcggtt gtgaatggaa gaaatttcgt gatccttccc   600
 601 ttcgtcagag attacaagag actgatggac ggtgacaggg gaccgaacac gggaggtatg   660
 661 ggctcctggg ggcctgtaga aatcccttcc gatacgatca aaaagatcga agagctcttc   720
 721 gataagactc tgtggggagt ggagaaagaa ggctacgcgt accgggggtt cctctacttg   780
 781 ggtctcatgc tccacgatgg tgatccctac atactcgagt acaatgtgag actgggcgat   840
 841 ccagaaacag aagtgatagt gacgttgaat cccgaaggat ttgtcaacgc ggttctcgag   900
 901 ggataccgcg gtggtaaaat ggagccggtg gaaccgcgtg gattcgccgt ggacgtggtt   960
 961 ctcgcagcga ggggctatcc cgacgctccc gaaaagggca aagagatcac ccttcccgaa  1020
1021 gaaggtctca tattcttcgc gggagtcgcg gagaaagatg gaaaactcgt aaccaatggc  1080
1081 ggtcgtgttc ttcactgtat gggaacagga gaaacgaaag aagaggcacg aagaaaggct  1140
1141 tacgaactcg cggaaaaggt ccacttcgaa ggtaagacct acaggaggga tatcgctcta  1200
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1275522 1276724 3 Glimmer3 score - -
Genemark probabilities .98   .98 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu