LOADING...
   TM1249;TM1249
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1249    TM1249            JCSG 360132 PDB Deposition 05-APR-13              PDB id: 1zcz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1249
DESCRIPTIONPhosphoribosylaminoimidazolecarboxamide formyltransferase (EC 2.1.2.3) / IMP cyclohydrolase (EC 3.5.4.10)
ORGANISMThermotoga maritima
COMMENTBifunctional purine biosynthesis protein purH .
Perfect genome and functional context: clustering on a chromosome with another enzymes of De novo Purine biosynthesis subsystem:
TM1244 - Phosphoribosylformylglycinamidine synthase, purS subunit (EC 6.3.5.3)
TM1245 - Phosphoribosylformylglycinamidine synthase, purL subunit (EC 6.3.5.3)
TM1246 - Phosphoribosylformylglycinamidine synthase, purQ subunit (EC 6.3.5.3)
TM1247 - Amidophosphoribosyltransferase (EC 2.4.2.14)
TM1248 - Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)
TM1250 - Phosphoribosylamine--glycine ligase (EC 6.3.4.13)
TM1251 - Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1)

-!- CATALYTIC ACTIVITY: 10-FORMYLTETRAHYDROFOLATE + 5-AMINO-1-(5-
PHOSPHO-D-RIBOSYL)IMIDAZOLE-4-CARBOXAMIDE = TETRAHYDROFOLATE + 5-
FORMAMIDO-1-(5-PHOSPHO-D-RIBOSYL)IMIDAZOLE-4-CARBOXAMIDE.
-!- CATALYTIC ACTIVITY: IMP + H(2)O = 5-FORMAMIDO-1-(5-PHOSPHO-D-
RIBOSYL)IMIDAZOLE-4-CARBOXAMIDE.
-!- PATHWAY: DE NOVO PURINE BIOSYNTHESIS; NINTH STEP.
-!- PATHWAY: DE NOVO PURINE BIOSYNTHESIS; TENTH STEP.
-!- DOMAIN: THE IMP CYCLOHYDROLASE ACTIVITY RESIDES IN THE N-TERMINAL
REGION (BY SIMILARITY).
-!- SIMILARITY: BELONGS TO THE PURH FAMILY.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; PUR9_THEMA
DR SPTR; Q9X0X6 (flat text); Q9X0X6 (good view)
DR GenBank; AAD36324
DR Pfam; PF01808; AICARFT_IMPCHas;
DR Pfam; PF02142; MGS;
DR Interpro; IPR002695; AICARFT_IMPCHas;
DR Interpro; IPR004362; MGS_like;
DR PDB; 1ZCZ; Identical; 26-APR-05; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 3ZZM; Highly similar; 28-SEP-11; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 4A1O; Highly similar; 28-SEP-11; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 4EHI; Highly similar; 06-JUN-12; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 1G8M; Highly similar; 27-APR-01; AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE;
DR PDB; 1THZ; Highly similar; 07-SEP-04; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 2B1G; Highly similar; 21-NOV-06; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR PDB; 2B1I; Highly similar; 21-NOV-06; BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH;
DR KEGG; 2.1.2.3/3.5.4.10; Enzyme page
DR FFAS; 283114; Fold and function assignment.
DR TVPC; TM1249; Homologs in PDB, JCSG and SG center.
DR OVP; TM1249; Ortholog view popup.
DR TPM; TM1249; Target PDB monitor.
DR FSS; TM1249; Target function coverage.
PROPERTY Residues: 452 aa
Molecule Weight: 49864.66 Dalton
Isoelectric Point: 5.49
Extinction Coefficient: 56380
Gravy Index: -.1
Number of Met residues: 8
Percentage of Met residues: 1.77 %
Number of Cys residues: 1
Percentage of Cys residues: 0.22 %
SEQUENCE  amino acids 452 aa
>TM1249  TM1249 phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase (purH)
MKRILVSLYEKEKYLDILRELHEKGWEIWASSGTAKFLKSNGIEANDVSTITGFENLLGG
LVKTLHPEIFAGILGPEPRWDVVFVDLYPPPDIDIGGVALLRAAAKNWKKVKPAFDMETL
KLAIEIDDEETRKYLAGMTFAFTSVYDSIRANQFVEGISLAFKREDLQLRYGENPHEKAF
VYGKPAFEILHEGKTISFNNILDAENAWFMAKNLPRMGAVVVKHQSPCGAAIGEDKVEIV
KKAIEADDESSFGGILAVNFEMDEEVAKSLKKYLEVIVAPSFTQEAIEVLSKKKVRLLKP
GDYASWAGKMAFGSLVLSERKYPEGNFELVVGEPLSEKELEDLEFAYRVVEGAKSNAVLI
AKDGVTVGIGSGQPSRKRAAWIATVMAGEKAKGAVAASDAFFPFPDSLEILAQAGVKAVV
APLGSIRDEEVIEKARELGITFYKAPSRVFRH

CDS  cDNA 1356 bp
   1 ttgaagagga tattggttag tctctacgag aaagaaaaat atctggatat tctgagagaa    60
  61 ctccacgaaa aaggctggga gatctgggcg agctccggca ccgccaagtt tttgaaatca   120
 121 aacggaatag aagcaaacga cgtgagcacc ataacgggtt tcgagaatct cctcggaggg   180
 181 ctcgtgaaga ccctccaccc ggagatattc gccggcatcc tcggaccgga acccagatgg   240
 241 gatgtggtct ttgtggacct atatccaccc ccagacatcg acataggagg agtcgctctt   300
 301 cttcgagcag ctgccaaaaa ctggaaaaag gtgaaacccg ctttcgacat ggaaacactc   360
 361 aaactcgcga ttgagataga cgacgaagag acgagaaagt acctcgctgg aatgaccttt   420
 421 gcgttcacca gtgtgtacga ttcgataagg gccaaccagt ttgtcgaggg tatttctctc   480
 481 gccttcaaga gggaagatct tcagctgagg tacggagaga accctcacga aaaagcgttt   540
 541 gtgtatggaa aaccagcttt tgagattctg cacgaaggaa agacaatctc attcaacaac   600
 601 atcttagacg cggaaaacgc gtggttcatg gcgaagaacc tgccgaggat gggtgcggtt   660
 661 gtggtgaaac accaatctcc ctgtggtgct gcgataggag aagacaaagt ggaaatcgtg   720
 721 aagaaggcca tcgaggcgga cgacgaatcc agttttggag ggatcctggc cgtgaacttc   780
 781 gaaatggacg aagaagttgc gaagtcattg aaaaagtacc tcgaggtgat cgtggcacct   840
 841 tccttcacac aggaagcgat cgaggttctc tctaagaaaa aagtgcgtct cttgaagcct   900
 901 ggggattacg cttcgtgggc tggaaagatg gcattcggtt ctctcgtcct gagtgaaaga   960
 961 aagtaccccg aagggaattt tgaactggta gttggagagc ctctctcgga aaaagagctt  1020
1021 gaggatctgg aattcgctta ccgtgttgtg gaaggagcga aatccaacgc tgttctcata  1080
1081 gcaaaagacg gtgtaactgt gggaataggg agcgggcagc cttcgagaaa gagagctgcc  1140
1141 tggatcgcca ccgtgatggc aggagaaaaa gcgaagggag cggttgcggc ttccgatgcg  1200
1201 ttcttcccgt tcccggactc gctcgaaata ctcgctcagg ctggtgtgaa agcggtggtc  1260
1261 gctcctctcg gatccataag agacgaagaa gtgatcgaaa aagccagaga acttggaatc  1320
1321 acgttctaca aagctccgag cagggttttc aggcac  1356
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1274160 1275518 3 Glimmer3 score 14.96 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu